DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zye and CG12814

DIOPT Version :9

Sequence 1:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster
Sequence 2:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster


Alignment Length:327 Identity:68/327 - (20%)
Similarity:115/327 - (35%) Gaps:95/327 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IDVKCDQGSGMMVEVEFSEDFEGVIYSQGYFSDPKCNYVKGDRSGR-SFTFTV-----PYDGCG- 115
            :...|..|: |.::|:.|..:.|.::.:.| ..|.| ...||.|.: :|:..:     ..|.|| 
  Fly    42 VTATCKAGT-MNIKVKMSSGYTGAVHVRDY-RTPGC-MAMGDGSDQVAFSLNLWAKQGASDYCGI 103

  Fly   116 -----------SKPSCSVCASIENILIIQDDRDIQNSFDIARKISCSR-GDEREKTVYFKPFVVD 168
                       .:.|..:...:...|.:.||:     |.:   |:|.: |..|:...:   .|:.
  Fly   104 LVSNVSGSNRTEERSIQLAVRVHKTLELADDK-----FYV---ITCGKSGYARDDNAH---VVLK 157

  Fly   169 MLEVISVDTPSGPVECWMEIGTGTPPNVKPIQGTLTLGTDITFTINVKHSEQAWDINILQCYASD 233
            .||                       |...::.|: .|.:.............:.:.:..|:|.|
  Fly   158 FLE-----------------------NDHRVRETV-YGHEYKIRAEFSKPNDTYGLRVGNCFAFD 198

  Fly   234 DMDFEARTTKRLQLSDKRGCSIKEKIFGEW------RKFEAGSSLTSTYYNTLKAFRFPDRSQVY 292
            ..:   ||.|   |:|..||....||...:      |..||..|         ..|:||:.|:|:
  Fly   199 KKN---RTQK---LTDDSGCPYDSKIISRFVPTADGRAAEAVLS---------SMFKFPEGSEVH 248

  Fly   293 LKCDIELCNGACKRDYTCGSLRSLTCPEGSTDPQCLQDHLISPKPRCYPGSNEPGCPRPTSPPPT 357
            |:||:..|.|.|.....|..:......:|:..|:..             |.||.|    :|...|
  Fly   249 LQCDVIQCYGRCVEIDDCNDVALAGFGKGTNGPRKF-------------GPNEEG----SSLAGT 296

  Fly   358 TI 359
            |:
  Fly   297 TV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zyeNP_649220.1 ZP 61..313 CDD:214579 59/276 (21%)
CG12814NP_001262454.1 ZP 45..256 CDD:214579 55/263 (21%)
Zona_pellucida <181..256 CDD:278526 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.