DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zye and T01D1.8

DIOPT Version :9

Sequence 1:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster
Sequence 2:NP_001300591.1 Gene:T01D1.8 / 3896729 WormBaseID:WBGene00044641 Length:189 Species:Caenorhabditis elegans


Alignment Length:159 Identity:34/159 - (21%)
Similarity:64/159 - (40%) Gaps:34/159 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 VDTPSG---PVECWMEIGTGTPPNVKPIQGTLTLGTDITFTINVK----HSEQAWDINILQCYAS 232
            ::.|.|   ..||...:..|:....:.:...:.:|.:|..:.|..    |....:.:.:..|..|
 Worm    39 IELPVGRFPEPECKYSVHHGSDKLGRIVTSKVNIGDEIYHSWNCNYSGDHKNYLFCVMVNNCTIS 103

  Fly   233 DDMDFEARTTKRLQLSDKRGCSIKEKIF------GEWRKFEAGSSLTSTYYNTLKAFRFP---DR 288
            |..: |...|:::|:.|:.|||:...|.      |:   ..||          :|...|.   |.
 Worm   104 DSGE-EEIGTRKIQIIDENGCSVFPNILPDISYQGD---LSAG----------IKVHAFALDVDT 154

  Fly   289 SQVYLKCDIELC---NGACKRDYTCGSLR 314
            :.|:..|:|::.   :..|:|. .||:.|
 Worm   155 TAVHFTCNIKMLFKDHEQCQRP-RCGNQR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zyeNP_649220.1 ZP 61..313 CDD:214579 33/156 (21%)
T01D1.8NP_001300591.1 Zona_pellucida <39..179 CDD:391783 31/154 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167962
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.