DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zye and CG15020

DIOPT Version :9

Sequence 1:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster
Sequence 2:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster


Alignment Length:310 Identity:85/310 - (27%)
Similarity:141/310 - (45%) Gaps:57/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IEKIDVKCDQGSGMMVEVEFSEDFEGVIYSQGYFSDPKCNYVKGDRSGRS-FTFTVPYDGCGSKP 118
            ::.|:.:| |...|.:.:.|:..|.|::||.||..||.|.|:.|  |||. :.|.:..:.||:..
  Fly   217 VQHIEAEC-QDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYING--SGRDYYEFYIQLNRCGTLG 278

  Fly   119 SCSVCAS--------IENILIIQDDRDIQNSFDIARKISCSRGDEREKTVYFKPFVVDMLEVISV 175
            ..|:...        :.|.:.:|.:..|:..:|...|::|..|.:..|||.| ||       :.|
  Fly   279 KNSLQEESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWKTVTF-PF-------LDV 335

  Fly   176 DTPSG--------PVECWMEIGTGTPPNVKPIQGTLTLGTDITFTINVKHSEQAWDINILQCYAS 232
            :..:|        |.||:|||..|.......:.|.:.:|..:|..|.::.....:||.:..|||.
  Fly   336 EVATGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVNDCYAH 400

  Fly   233 DDMDFEARTTKRLQLSDKRGCSIKEKIFGEWRKFEAGSSLTSTYYNT-----LKAFRFPDRSQVY 292
            :.      ..||:||.|:.||.:.:|:...:|    ||...|..|.|     :|.|||.....:|
  Fly   401 NG------ANKRIQLIDQHGCPVDDKLISRFR----GSWSDSGVYETQVYAYMKTFRFTGSPALY 455

  Fly   293 LKCDIELCNGAC--------------KRDYTCGSLRSLTCPEGSTDPQCL 328
            ::||:.:|:|.|              |||.:..:..:::.|..|.|.:.|
  Fly   456 IECDVRMCHGRCPSQPCHWRNLKAVTKRDTSNMTATNISIPPLSADGEGL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zyeNP_649220.1 ZP 61..313 CDD:214579 80/287 (28%)
CG15020NP_647901.1 ZP 223..473 CDD:214579 77/270 (29%)
Zona_pellucida <371..472 CDD:278526 32/110 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473284
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14807
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.