DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zye and cutl-14

DIOPT Version :9

Sequence 1:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster
Sequence 2:NP_492780.2 Gene:cutl-14 / 182018 WormBaseID:WBGene00015231 Length:270 Species:Caenorhabditis elegans


Alignment Length:297 Identity:65/297 - (21%)
Similarity:119/297 - (40%) Gaps:70/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IDVKCDQGSGMMVEVEF--SEDFEGVIYSQGYFSDPKCNYVKGDRSGRSFTFTVPYDGCGSK--- 117
            ::|:|   :...:|..|  ..:|.|.::..|:..|..|  |..:...|:.:.|||.|.||.:   
 Worm    29 VEVEC---TDTTIEAVFLTETNFLGRVFVLGHSQDKDC--VSRETGRRTTSITVPRDKCGVETVQ 88

  Fly   118 --PSCSVCASIENILIIQDDRDIQNSFDIARKISC---SRGDEREKTVYFKPFVVDMLEVISVDT 177
              ......:|: ||:|...|:.: ...|.|..|:|   ..||.....:..:|.::..::|:: :.
 Worm    89 HGKGAGYTSSV-NIVISFHDKFL-TKVDRAYNITCLYAPTGDVVSYALTVQPSLLKDIQVLA-EQ 150

  Fly   178 PSGPVECWMEIGTGTPPNVKPIQGTLTLGTDITFTINVKHSEQAW-----DINILQCYASDDMDF 237
            ||...|.: ::.|..|..:..:...|               |..|     ::::......|.:..
 Worm   151 PSCEYEVF-DVRTRRPAEIVHVNAPL---------------EHVWTCDGTNLDLFCMTVHDCVIN 199

  Fly   238 EARTTKRLQLSDKRGCSIKEKIFGEWRKFEAGSSLTSTYYNTLKAFRFPDRSQVYLKCDIELCNG 302
            |.::.:|.::.|..|||:........| :| .:.|::...:  |||||.|...|..:|::.|   
 Worm   200 EGKSKRRSKIIDSEGCSLDTTRLPNLR-YE-NNKLSARVMS--KAFRFGDDVAVEFECNVRL--- 257

  Fly   303 ACKRDYTCGSLRSLTCPEGSTDPQCLQDHLISPKPRC 339
                     .||:.|        .|       |:|||
 Worm   258 ---------DLRNGT--------SC-------PRPRC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zyeNP_649220.1 ZP 61..313 CDD:214579 56/266 (21%)
cutl-14NP_492780.2 ZP 32..270 CDD:214579 62/292 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.