DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zye and cutl-10

DIOPT Version :9

Sequence 1:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster
Sequence 2:NP_492900.1 Gene:cutl-10 / 173021 WormBaseID:WBGene00013180 Length:403 Species:Caenorhabditis elegans


Alignment Length:304 Identity:66/304 - (21%)
Similarity:103/304 - (33%) Gaps:89/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DQGSGMMVEVEFSED-----------FEGVIYSQGYFSDPKC--NYVKGDRSGRSFTFTVPYDGC 114
            |.|...:.||:..||           |.|.|:.:|......|  ::|..  ..:..||.:....|
 Worm    24 DNGISELPEVDCMEDRVKLSFKTQRPFHGRIFVKGMVDKQACVRDFVTS--QAKDVTFELENGAC 86

  Fly   115 -------------GSKPSCSVCASIENILIIQDDRDIQNSFDIARKISCSRGDEREKTVYFKPFV 166
                         |.:.|.:|..|..:..|.:.||        |.:.:|.. .|.:|.|..| |.
 Worm    87 NMRRQRMLGPEKRGMEMSMTVIISFHSTFITKVDR--------AYRCTCFY-MEADKVVTNK-FD 141

  Fly   167 VDMLEVIS-VDTPSGPVECWMEIG----TGTPPNVKPIQGTLTLGTDITFTINVKHSEQAWDINI 226
            |.||.... :||...|: |...:.    ||      ||.....:|..:....|.:  ...:.:.:
 Worm   142 VSMLPTTDLIDTARMPL-CTYSVRRDSITG------PIVEFAKVGETVYHVWNCE--SDMFSMLV 197

  Fly   227 LQCYASDDMDFEARTTKRLQLSDKRGCSIKEKIFGEWRKFEAGSSLT-----STYYNTLKAFRFP 286
            ..|:..|     ....:|..|.|:.||:|...|..:         ||     :..|..:..|:|.
 Worm   198 HSCFVDD-----GNGDERKPLLDEHGCAIDPLILPD---------LTYNKDNNVAYAQVNTFKFA 248

  Fly   287 DRSQVYLKCDIELC---NGACKRDYTCGSLRSLTCPEGSTDPQC 327
            |:...|.:|.:..|   .|.|               :|.|.|:|
 Worm   249 DKVSTYFQCAVSTCMNTEGMC---------------DGKTPPRC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zyeNP_649220.1 ZP 61..313 CDD:214579 62/288 (22%)
cutl-10NP_492900.1 ZP 35..279 CDD:214579 62/293 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.