DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and slc7a7

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001032648.1 Gene:slc7a7 / 641560 ZFINID:ZDB-GENE-051127-5 Length:501 Species:Danio rerio


Alignment Length:396 Identity:96/396 - (24%)
Similarity:171/396 - (43%) Gaps:38/396 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DIALLG-----IGHMVGAGIYVLTGTVAKEMAGPGI-ILSFILAGFISMLAALCYAEFGTRVPKA 101
            :|:||.     :|:|:|:||:|....|.......|: ::.:.:.|..|:..||||||.||.:.|:
Zfish    35 EISLLNGVCLIVGNMIGSGIFVSPKGVLMYSGSYGLSLVVWTIGGIFSVFGALCYAELGTTITKS 99

  Fly   102 GSAYVYTYISMGEFWAFVIGW-NILLEHMLGAASVARAWSGYV-----DSMLGGWIGNTTLELTG 160
            |::|.|...:.|.|.||:..| ::|:......|.:|..:|.|:     .:.:..::.|..|    
Zfish   100 GASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYVANRLL---- 160

  Fly   161 GIHEPGLAQYPDVLAFLVCI---VYAAALAGGVKATAVFNSLLTLVNIAVMVLVISVGFWYADGK 222
                         .|..:|:   |..|.:..|.:....|    |.|.:..::.||..|.......
Zfish   161 -------------AAACICLLTFVNCAYVKYGTRVQDFF----TYVKVVALIAVIITGLVKIFQG 208

  Fly   223 NWSEAEGGF--LPYGVGGVIAGAATCFYAFVGFDSIATSGEEAKNPSVSIPVATVISLFVVTVGY 285
            .....||.|  ..:..|.|.....:..:::.|:|::....||.|||..::|:|..||:.:|||.|
Zfish   209 YTQNFEGLFSDSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAISMPIVTVIY 273

  Fly   286 ILVSAALTLMIPISEINPAASLPEAFGQLNLSWAKYLISIGALCGMTTTLLGSLFALPRCMYAMA 350
            ||.:.|...::||..|..:.::...|......:..:.|.:.........|..|:.|..|..:..:
Zfish   274 ILTNLAYYTILPIPAILDSDAVAVTFADQVFGYLNWTIPVAVAFSCFGGLNASIVAASRLFFVGS 338

  Fly   351 SDGLLFSCFGKINPTTQVPLLNLVVSGVMSACLALVFDLAKLVEFMSIGTLLAYTIVSASVIILR 415
            .:|.|......|:.|...|:..|:.:|.|:.....|.|:.||:.:.|........:.....:.||
Zfish   339 REGHLPDYLCMIHITRFTPIPALLFNGAMALVYLCVEDVFKLINYYSFSYWFFVGLSILGQLYLR 403

  Fly   416 YRPMER 421
            ::..:|
Zfish   404 WKQPDR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 96/396 (24%)
AA_permease_C 551..601 CDD:290617
slc7a7NP_001032648.1 2A0308 2..492 CDD:273332 96/396 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.