DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and Slc7a14

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001128087.1 Gene:Slc7a14 / 499587 RGDID:1594375 Length:412 Species:Rattus norvegicus


Alignment Length:413 Identity:102/413 - (24%)
Similarity:174/413 - (42%) Gaps:108/413 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 LFSCF-GK-----INPTTQVPLLNLVVSGVMSACLALVFDLAKLVEFMSIGTLLAYTIVSASVII 413
            :..|| ||     ::..|:.|::..:|||.::|.|:|:..|..|:|.||||||||||:||..|::
  Rat     5 VMGCFSGKGFLAHVSSYTETPVVACIVSGFLAALLSLLVSLRDLIEMMSIGTLLAYTLVSVCVLL 69

  Fly   414 LRYRPMERIHTTIRVPAVAGSPDDDDDDDEDVASQSSMDTSSPTSEMIE---------------- 462
            |||:|...|...::..:     ::.....|.:.:....:|.||.||..|                
  Rat    70 LRYQPESDIDGFVKFLS-----EEHTKKKEGILADCEKETCSPVSEGEEFSSPATNTCGAKNLPS 129

  Fly   463 ----EVLAGRL-KAQFRCLEPLLGRFE-----------------------------------PGS 487
                |:|.|:. |:.:....|..|..:                                   ||.
  Rat   130 LGDNEMLIGKSDKSAYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPRYYTMRIRLGLPGK 194

  Fly   488 V----------VSVAVMLFIFLSFAICVELKVSWTQLYTG-TWWALIIYGFIIFAAGTCVAVIAV 541
            :          |::.|:|...|.|..| ...:..::..:| :|||:::...::......|.||..
  Rat   195 MDRPTAATGHTVTICVLLLFILMFIFC-SFVIFGSEYISGQSWWAILLVVLMLLLITVLVFVILQ 258

  Fly   542 HNQNTRGLIFKVPLVPFVPALGIFCNILLMVHLDAVTWVRFFVWVCIGMVVYFLYGIRNS----- 601
            ..:|.:.|.:..|.:|||||..:..||.||:.|..:||:||.||..:||::||.|||.||     
  Rat   259 QPENPKKLPYMAPCLPFVPAFAMLVNIYLMLKLSTITWIRFAVWCFVGMLIYFGYGIWNSTLEIS 323

  Fly   602 -----------KEGEVCSSYSI----LMTTSEAGKVPWGS--------FKATSGGKKSSKHSIFE 643
                       :..:|...:|:    ...|....:..||.        ::..|..|.:|:.|...
  Rat   324 AREQALHQSTYQRYDVDDPFSVEEGFSYATEGESQEDWGGPAEDKGFYYQQMSDAKANSRTSSKA 388

  Fly   644 RFTGRSKPEDKKSIVEESENETS 666
            :...:.| ::.::::|..|.:.|
  Rat   389 KSKSKHK-QNSEALIENDELDCS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 89/336 (26%)
AA_permease_C 551..601 CDD:290617 24/49 (49%)
Slc7a14NP_001128087.1 AA_permease_C 268..318 CDD:290617 24/49 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000131
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X81
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.