DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and CG1607

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001263139.1 Gene:CG1607 / 43707 FlyBaseID:FBgn0039844 Length:507 Species:Drosophila melanogaster


Alignment Length:418 Identity:104/418 - (24%)
Similarity:178/418 - (42%) Gaps:82/418 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IGHMVGAGIYV-------LTGTVAKEMAGPGIILSFILAGFISMLAALCYAEFGTRVPKAGSAYV 106
            :|.::|:||:|       .||:|  .:|    ::.::::|..||:.|.||||.||.:.|:|:.|.
  Fly    59 VGSIIGSGIFVSPTGVLMYTGSV--NLA----LIVWVISGLFSMVGAYCYAELGTMITKSGADYA 117

  Fly   107 YTYISMGEFWAFVIGWNILLEHML----GAASVARAWSGYVDSMLGGWIGNTTLELTGGIHEPGL 167
            |...:.|.|.||:..|   :|.|:    ..|.||..:|.||   |..:....|         |  
  Fly   118 YIMETFGPFMAFIRLW---IECMIVRPCSQAIVALTFSTYV---LKPFFPECT---------P-- 165

  Fly   168 AQYPDVLAFL--VCIVYAAALAG--GVK-ATAVFNSLLTLVNIAVMVLVISVGFW--YADGKNWS 225
               |:..|.|  ||.:....|..  .|| |||| ..:.|...:..:.::|:.|.:  |.....:.
  Fly   166 ---PEDSARLLAVCCILVLTLINCWDVKWATAV-QDIFTYAKLLALFIIIATGVYQLYLGNTQYF 226

  Fly   226 EAEGGFLPYGVGGVIAGAATCFY----AFVGFDSIATSGEEAKNPSVSIPVATVISLFVVTVGYI 286
            ..|      .....:...|..||    |:.|::.:....||.|:|..::|.|..||..:||:.|:
  Fly   227 TFE------NTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYV 285

  Fly   287 LVSAALTLMIPISEINPAASL-----PEAFGQLNLSWAKYLISIGALCGMTT--TLLGSLFALPR 344
            :.:.:...::...|:..::::     ..|||.  |:|     :|.....::|  .:.|.|....|
  Fly   286 MANVSFYTILSPDEVMGSSAVAVTYAERAFGM--LAW-----TIPVFVALSTFGAVNGILLTSSR 343

  Fly   345 CMYAMASDGLLFSCFGKINPTTQVPLLNLVVSGVMSACLALVFDLAKLVEFMSIGTLLAYTIVSA 409
            ..||.|::|.:......|......|...::...::|.....|.|:..|:.::...|.|:..:...
  Fly   344 LFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVL 408

  Fly   410 SVIILRY------RPMERIHTTIRVPAV 431
            .:..||:      ||       ||||.|
  Fly   409 CLPWLRWAQPNLPRP-------IRVPMV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 104/418 (25%)
AA_permease_C 551..601 CDD:290617
CG1607NP_001263139.1 2A0308 42..501 CDD:273332 104/418 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.