DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and gb

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001287555.1 Gene:gb / 43265 FlyBaseID:FBgn0039487 Length:517 Species:Drosophila melanogaster


Alignment Length:437 Identity:110/437 - (25%)
Similarity:199/437 - (45%) Gaps:59/437 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RTKSVPTDVMETPLNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGPGI-ILSFILAGFISM 85
            |..|..:|.....:.:.|...:...:.:|.:.|:||:|....|.:|:...|. ::.::|.|.:||
  Fly    42 REGSAESDSSRVVIKKQLGLLEGVAIILGIIFGSGIFVSPKGVIREVESVGASLVIWVLCGLLSM 106

  Fly    86 LAALCYAEFGTRVPKAGSAYVYTYISMGEFWAFVIGWNILLEHM-LGAASVARAWSGYV-DSMLG 148
            :.||||||.||.:||:|..|.|.:.:.|...||:..|:.::..: ...|.:...::.|| :...|
  Fly   107 IGALCYAELGTAIPKSGGDYAYIFEAYGSLPAFLYLWDAMMIFVPTTNAIMGLTFASYVLEPFFG 171

  Fly   149 G--WIGNTTLELTGGIHEPGLAQYPDVLAFLVCI--VYAAALAGGVKATAVFNSLLTLVNIAVMV 209
            |  .|....|:|...|          .:.||..:  .|       :|.|....:::....||.:|
  Fly   172 GACEIPKIALQLLAAI----------TICFLTYLNSYY-------MKVTTKMQNVIMFTKIAALV 219

  Fly   210 LVISVGF-WYADG--KNW------SEAEGGFLPYGVGGVIAGAATCFY----AFVGFDSIATSGE 261
            |:|.||. |...|  :|:      :|.:.|.:           :..||    ::.|::.:....|
  Fly   220 LIILVGLVWMMMGNVENFTRPFDNTETDPGKM-----------SVAFYSGIFSYAGWNYLNFMTE 273

  Fly   262 EAKNPSVSIPVATVISLFVVTVGYILVSAALTLMIPISEINPAASLPEAFGQLNLSWAKYLI--- 323
            |.::|..::|.|..|||.:||..|:|.:.|...::..||:..:.::...||...|.....:|   
  Fly   274 ELRDPYRNLPRAIYISLPLVTGIYVLANVAYLAVLSPSEMIASNAIAVTFGDKILGVFSLIIPLM 338

  Fly   324 -SIGALCGMTTTLLGSLFALPRCMYAMASDGLLFSCFGKINPTTQVPLLNLVVSGVMSACLALVF 387
             :|.|..|::..::.|    .|..:..|.:|.:.:....|:..:..||.:||....:|..:.:|.
  Fly   339 VAISAFGGLSVHIMTS----SRICFVGARNGHMPAILSHISVKSYTPLPSLVFLCFLSIVMLVVS 399

  Fly   388 DLAKLVEFMSIGTLLAYTIVSASVIILRY-RP-MER-IHTTIRVPAV 431
            |:..|:.:.||.......:..::|:..|| || ||| |...:.:||:
  Fly   400 DVYVLITYASIVESFFIMLSVSAVLYFRYTRPCMERPIKVAMWIPAL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 107/427 (25%)
AA_permease_C 551..601 CDD:290617
gbNP_001287555.1 2A0308 32..515 CDD:273332 110/437 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.