DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and mnd

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_524074.1 Gene:mnd / 39625 FlyBaseID:FBgn0002778 Length:499 Species:Drosophila melanogaster


Alignment Length:455 Identity:112/455 - (24%)
Similarity:198/455 - (43%) Gaps:85/455 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VPTDVMETP-------------------LNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGP 71
            :|..|.|.|                   |.:.:...|...:.:|.:||:||:|....|.|.....
  Fly    11 IPRQVFEVPPAEPNNSTADSGSQGSGVKLKKQIGLLDGVAIIVGVIVGSGIFVSPKGVLKFSGSI 75

  Fly    72 G-IILSFILAGFISMLAALCYAEFGTRVPKAGSAYVYTYISMGEFWAFVIGWNILLEHMLGAASV 135
            | .::.::|:|.:||:.||||||.||.:||:|..|.|...:.|...||:..|..||  :|...  
  Fly    76 GQSLIVWVLSGVLSMVGALCYAELGTMIPKSGGDYAYIGTAFGPLPAFLYLWVALL--ILVPT-- 136

  Fly   136 ARAWSGYVDSMLGGWIGNTTLELTGGIH---------EPGLAQYPDVLAFLVCIV-----YAAAL 186
                            ||....||..|:         :..:.....:.|.::|::     |    
  Fly   137 ----------------GNAITALTFAIYLLKPFWPSCDAPIEAVQLLAAAMICVLTLINCY---- 181

  Fly   187 AGGVKATAVFNSLLTLVNIAVMVLVISVGFWYA-DG--KNWSEAEGGFLPYGVG----GVIAGAA 244
              .||.......:.|...:..:::::..|.|:. ||  ::|..      |:..|    |.||.| 
  Fly   182 --NVKWVTRVTDIFTGTKVVALLVIVGAGVWWLFDGNTEHWDN------PFSGGLQDPGYIALA- 237

  Fly   245 TCFY----AFVGFDSIATSGEEAKNPSVSIPVATVISLFVVTVGYILVSAALTLMIPISEINPAA 305
              ||    ::.|::.:....||.|:|..::|.|..||:.||||.|::.:.|...::...||..:.
  Fly   238 --FYSGLFSYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPDEILSSD 300

  Fly   306 SLPEAFGQLNLSWAKYLISIGALCGMTTTLLGSLFALPRCMYAMASDGLLFSCFGKINPTTQVPL 370
            ::...||...|.:..:::.....|....:|.|::||..|..:..|.:|.|.:....||.....|:
  Fly   301 AVAVTFGDKMLGYMSWIMPFAVACSTFGSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLTPV 365

  Fly   371 LNLVVSGVMSACLALVFDLAKLVEFMSIGTLLAYTIVSASVII-LRYR--PMER-IHTTIRVPAV 431
            .:|:..||::..|..:.|:..|:.::|....| :|::|.|.:: :||:  ..|| |...:.:|.:
  Fly   366 PSLIFLGVLTLLLLFIEDVYVLINYVSYVEAL-FTLISVSGLLWMRYKQPKTERPIKVNLALPII 429

  Fly   432  431
              Fly   430  429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 110/449 (24%)
AA_permease_C 551..601 CDD:290617
mndNP_524074.1 2A0308 22..496 CDD:273332 108/444 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.