DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and Slc7a15

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001100184.1 Gene:Slc7a15 / 298873 RGDID:1560726 Length:488 Species:Rattus norvegicus


Alignment Length:418 Identity:100/418 - (23%)
Similarity:184/418 - (44%) Gaps:53/418 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGPGI-ILSFILAGFISMLAALCYAEFGTRV 98
            :.|.:..:....:..|.|:|:||::....|...:..||. ::.:...|.:::|.||||||.|:.|
  Rat    27 MKREIGLWSAVSMTAGCMIGSGIFMSPQGVLVYIGSPGASLIIWATCGLLALLGALCYAELGSLV 91

  Fly    99 PKAGSAYVYTYISMGEFWAFVIGWNILLEHMLGAASVARAWS-GYVDSMLGGWIGNTTLELTGGI 162
            |::|..|.|...:.|...||::.:.|:|   :|..:...|.| .:.:..|..:.           
  Rat    92 PESGGEYAYILRAFGSLPAFLVIYIIVL---VGRPAAITAVSLSFAEYALAPFY----------- 142

  Fly   163 HEPGLAQYPDVLAFLV---CIVYAAALA--GGVKATAVFNSLLTLVNIAVMVLVISVGFWYADGK 222
              ||.:..|.|:..:|   ||:....:.  ....:|.:.|........:::|:|:......|.|:
  Rat   143 --PGCSSVPQVIVKIVACSCILVLLLINFWSSRMSTVLMNVCTAAKLFSLLVIVVGGAVGLAQGR 205

  Fly   223 -----------NWSEAEGGFLPYGVGGVIAGAATCFY----AFVGFDSIATSGEEAKNPSVSIPV 272
                       |.::..|..          |.|  ||    :|.|:.:|.|..||.|||..::..
  Rat   206 IPTESLLFAFHNTTQQAGRI----------GMA--FYQGLWSFDGWSNINTVIEEIKNPKQNLVW 258

  Fly   273 ATVISLFVVTVGYILVSAALTLMIPISEINPAASLPEAFG-QLNLSWAKYLISIGALCGMTTTLL 336
            |.||::.:||:.|:||:.:..|::..|||..:.::...:| |:..||| :|:.:.........:.
  Rat   259 AVVIAIPLVTILYVLVNISYLLVMSPSEILTSDAIAVTWGNQVLGSWA-WLVPLAVALSTFGAVN 322

  Fly   337 GSLFALPRCMYAMASDGLLFSCFGKINPTTQVPLLNLVVSGVMSACLALVFDLAKLVEFMSIGTL 401
            |..|:..|..||.|.:|.:......|:.....|...|:.:..::..|.:..:.:..|..:|..:.
  Rat   323 GGFFSGSRVCYAAAREGHMPQLMSMIHVHRLTPAPALIFTTAVALLLVIPGNFSTFVNLLSFLSW 387

  Fly   402 LAYTIVSASVIILRYRPMERIHTTIRVP 429
            |.|....|.::.||.: ...:|.|.:||
  Rat   388 LTYGTTFACLLYLRIK-TRNLHHTYKVP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 100/418 (24%)
AA_permease_C 551..601 CDD:290617
Slc7a15NP_001100184.1 2A0308 4..481 CDD:273332 100/418 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.