DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and SPAPB24D3.02c

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_593989.1 Gene:SPAPB24D3.02c / 2543419 PomBaseID:SPAPB24D3.02c Length:543 Species:Schizosaccharomyces pombe


Alignment Length:530 Identity:121/530 - (22%)
Similarity:220/530 - (41%) Gaps:162/530 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LTGTVAKEM---AGPGIILSFILAGFISMLAALCYAEFGTRVPKAGSAYVYT-YISMGEFWAFV- 119
            |.|::|..|   || |::.|:.:.....:..|...:|..:.:|.:||.|.:| |:|..::.||: 
pombe    66 LVGSMAFSMNCGAG-GMVWSWFVGATCLLPIAFALSELASSMPTSGSLYFWTAYLSPPKYRAFLS 129

  Fly   120 --IGWNILLEHMLGAASVARAWSGYVDSMLGGWIGNTTLELTGGIHEPGLA--QYPDVLAFLVCI 180
              :|:.:.|.:..|.||...|.:|.|             :.|..:..|..|  :|.: ....|.:
pombe   130 WFLGYVLALAYSTGFASTIYAAAGLV-------------QATASVANPSYAPTKYEE-YGIYVAL 180

  Fly   181 VYA--AALAGGVKATAVFNSLLTLVNI-AVMVLVISV------------GFWYADGKNWSEAEGG 230
            .:|  |.:....|..|.|:|...:..| .:::.:||:            .:.:.:.:|:|    |
pombe   181 SFACSALIVLPTKFLARFSSFNVVFQICTILIFIISLAASSTSETRNTGSYIFGNFENYS----G 241

  Fly   231 FLPYGVGGVIAGAATCF----YAFVGFDSIATSGEEAKNPSVSIPVATVISLFV-VTVGY-ILVS 289
            :...|...::     ||    :...||:|.||..|||||.|.:.|:|.:.||.| :.:|: |:::
pombe   242 WTNMGWSFIL-----CFTTPVWVLSGFESCATIVEEAKNASKAAPIAIISSLTVSLFMGFCIMIT 301

  Fly   290 AALTLMIPISEINPAASLPEAFGQLNLSWAKY--LISIGALCGMTTTLLGSL--------FALPR 344
            .|.|:....|.|     |...:|: .:|...|  |...||: |::..|:.:|        .|..|
pombe   302 IAGTMGHDFSSI-----LNTPYGE-PVSQVLYNNLGKRGAV-GVSAVLIIALCFNCSALCLASSR 359

  Fly   345 CMYAMASD-GLLFS-CFGKIN----PTTQVPLLNL--VVSGVMS----ACLALVFDLAKLVEFMS 397
            .::|.|.| ||..| .|.|:.    |...:.|:||  ::.|::.    ..::.:|:||.:..|:|
pombe   360 EIFAFARDKGLPGSWIFRKLTPGGIPLNAILLVNLYTIIVGLLMLVNVTAISSIFNLAIIAFFIS 424

  Fly   398 IGTLLAYTIVSASVIILRYRPMERIHTTIRVPAVAGSPDDDDDDDEDVASQSSMDTSSPTSEMIE 462
                  |::                      |.|.                              
pombe   425 ------YSL----------------------PLVC------------------------------ 431

  Fly   463 EVLAGRLK-AQFRCLEPLLGRF-EPGSVVSVA-----VMLFIFLSFAICVELKVSWTQLYTGTWW 520
            .:|..||. .:|.|     |:| :|.|:|:||     .::.:|.|:....:::::         |
pombe   432 RLLFNRLNPGKFYC-----GKFSKPISIVAVAWLWFMALMLLFPSYQNPNKVEMN---------W 482

  Fly   521 ALIIYGFIIF 530
            |:::.||.:|
pombe   483 AIVVLGFTVF 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 121/530 (23%)
AA_permease_C 551..601 CDD:290617
SPAPB24D3.02cNP_593989.1 2A0304 34..512 CDD:273331 121/530 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I2865
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2006
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.