DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and isp5

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_595000.1 Gene:isp5 / 2543028 PomBaseID:SPAC1039.09 Length:580 Species:Schizosaccharomyces pombe


Alignment Length:428 Identity:92/428 - (21%)
Similarity:165/428 - (38%) Gaps:77/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PTDVMETPLNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGPGIILSFILAGFISMLAALCY 91
            |.|.....|.|.|....|.::|||..:|.|::|.:....:|.....:::.:.|.|.:.::.....
pombe    71 PEDGKPQKLKRTLTARHIQMIGIGGAIGTGVWVGSKNTLREGGAASVLICYSLVGSMVLMTVYSL 135

  Fly    92 AEFGTRVPKAGSAYVYTYISMGEFWAFVIGWNILLEHM------LGAASVARAWSGYVDSMLGGW 150
            .|.....|..||.:.|....:...|.|.:|||.|...:      |..||:.          |..|
pombe   136 GELAVAFPINGSFHTYGTRFIHPSWGFTLGWNYLASFLATYPLELITASIC----------LQFW 190

  Fly   151 IGNTTLELTGGIHEPGLAQYPDVLAFLVCIVYAAALAGGVKATAVFNSL--LTLVNIAVMVLVIS 213
            |     .:..||       :..|...|:|.|....:.|..:.....:||  :.:|...:..:||.
pombe   191 I-----NINSGI-------WITVFIALLCFVNMFGVRGYGEVEFFVSSLKVMAMVGFIICGIVID 243

  Fly   214 VGFWYADGKNWSEA----EGGFLPYGVGGVIAGAATCFYAFVGFDSIATSGEEAKNPSVSIPVAT 274
            .|....|.:.:..|    :..|: :|..|..:..:|..:::.|.:.|..:..|.|||:.:.|.| 
pombe   244 CGGVRTDHRGYIGATIFRKNAFI-HGFHGFCSVFSTAAFSYAGTEYIGIAASETKNPAKAFPKA- 306

  Fly   275 VISLFV-VTVGYILVSAALTLMIP-----ISEINPAASLP--EAFGQLNLSWAKYLISIGALCGM 331
            |..:|: |::.|||....::|:|.     ::.::..|:.|  .|.....:....::::...|..:
pombe   307 VKQVFIRVSLFYILALFVVSLLISGRDERLTTLSATAASPFILALMDAKIRGLPHVLNAVILISV 371

  Fly   332 TTTLLGSLFALPRCMYAMASDG-------------------LLFSCFGKINPTTQVPLLNLVVSG 377
            .|...|..:...|.:::||..|                   ....|||.:....:          
pombe   372 LTAANGITYTGSRTLHSMAEQGHAPKWFKYVDREGRPLLAMAFVLCFGALGYICE---------- 426

  Fly   378 VMSACLALVFDLAKLVEFMSIGTLLAYTIVSASVIILR 415
              ||....|||.  |:...::.||..:..::.|.||.|
pombe   427 --SAQSDTVFDW--LLSISNLATLFVWLSINVSYIIYR 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 90/423 (21%)
AA_permease_C 551..601 CDD:290617
isp5NP_595000.1 LysP 37..579 CDD:223903 92/428 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I1891
OMA 1 1.010 - - QHG53617
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X81
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.