DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and SPBPB2B2.01

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_596849.1 Gene:SPBPB2B2.01 / 2541403 PomBaseID:SPBPB2B2.01 Length:585 Species:Schizosaccharomyces pombe


Alignment Length:453 Identity:92/453 - (20%)
Similarity:170/453 - (37%) Gaps:78/453 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSSRRAILRHILSGICTKMNRTKSVPTDVMETPLNRCLNTFDIALLGIGHMVGAGIYVLTGTVA 65
            :|:....:.|..::|...:.|:..|....     |.|.|.:..|.::|||..:|.|::|.:....
pombe    50 VPAKEENVFRRFINGFKIEKNQQDSAGQG-----LKRRLKSRHIQMIGIGGAIGTGVWVGSSKSL 109

  Fly    66 KEMAGPGIILSFILAGFISMLAALCYAEFGTRVPKAGSAYVYTYISMGEFWAFVIGWNILLEHML 130
            .......:::.:.:.|.:.........|.....|..||...:....:.|.|.|.:.||       
pombe   110 YRGGAASVLIDYCIVGTMVFCTVYALGELAVAFPTRGSFVTHATRFIDESWGFALSWN------- 167

  Fly   131 GAASVARAWSGYVDSMLGGWIGNTTLELTGGI----HEPGLAQYPDVLAFLVCIVYAAALAGGVK 191
                       ||.|    :|....||||.|.    :...|.....|..|:|.:.:....  |||
pombe   168 -----------YVFS----FIVTIPLELTTGTMMIKYWTNLNSGIWVTVFIVFLFFINIF--GVK 215

  Fly   192 ATAVFNSLLTLVNIAVMV------LVISVGFWYADGKNWSEA----EGGFLPYGVGGVIAGAATC 246
            .......:::.:.:..|.      ::|..|....|.:.:...    |..| .:...|..|...:.
pombe   216 GYGEMEFIMSTIKVVAMCGFIILGIIIDCGGVPTDHRGYMGTHIFRENAF-RHKFKGFCAVFTSA 279

  Fly   247 FYAFVGFDSIATSGEEAKNPSVSIPVATVISLFVVTVGYILVSAALTLMIPISEINP-------- 303
            .::|.|.:.:..:..|.:||:.:.|||...:||.:.:.|||....::|:  ||..:|        
pombe   280 AFSFSGTEYVGVAAAETENPAKAFPVAVRQTLFRIAIFYILSLFIVSLL--ISGADPRLTSYHGV 342

  Fly   304 -AASLPEAFGQLNLSWAKYLISIGALCGMTTTLLGSLFALPRCMYAMASDGLLFSCFGKINPTTQ 367
             |:....|....|:.....:::...|..:.::....|:|..|.::::..:|....||..::...:
pombe   343 DASPFVLAIKDANIKALPSILNAIILISVISSANAQLYAGSRAIHSLGCNGFAPKCFTLVDREGR 407

  Fly   368 VPLLNLVVSGVMSACLALVFDLAKLVE-------------FMSIGTLLAYTIVSASVIILRYR 417
             ||:.|::       |.|...|..|||             ...:|||..:.  |..:..:|||
pombe   408 -PLVALLI-------LFLFMFLGYLVETGQYDTVFDWMLSISGLGTLFCWG--SICLAHIRYR 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 87/422 (21%)
AA_permease_C 551..601 CDD:290617
SPBPB2B2.01NP_596849.1 LysP 36..584 CDD:223903 92/453 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I1891
OMA 1 1.010 - - QHG53617
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X81
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.