DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and meu22

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_596348.1 Gene:meu22 / 2540779 PomBaseID:SPBC19F8.06c Length:574 Species:Schizosaccharomyces pombe


Alignment Length:372 Identity:78/372 - (20%)
Similarity:145/372 - (38%) Gaps:72/372 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PTDVMETPLNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGPGIILSFILAGFISMLAALCY 91
            |.|..:  |.|.|....:.::.||..||.|::|.:|....:.....|:::|.:.|...:......
pombe    52 PEDTQD--LQRKLKPRHMQMIAIGGCVGTGLFVGSGNALADGGPASILIAFAVIGTYVLFTTSAL 114

  Fly    92 AEFGTRVPKAGSAYVYTYISMGEFWAFVIG---W-----NILLEHMLGAASVARAW--SGYVDSM 146
            ||.....|.:||.|.|....:...|.|.:|   |     .:.|| :..|..:...|  ||.|.. 
pombe   115 AELSAIYPVSGSFYTYFSKFIDPAWGFAVGIQYWLSFAVTVPLE-LTVAPLIINFWNASGPVSI- 177

  Fly   147 LGGWIGNTTLELTGGIHEPGLAQYPDVLAFLVCIVYAAALAGGVKATAVFNSLLTLVNIAVMVLV 211
               || :....:...|:..|...|.:|..||..:                 .:::::...::.::
pombe   178 ---WI-SVFYVIIIAINIWGTEGYGEVEFFLSIM-----------------KVISVIGFVILSII 221

  Fly   212 ISVGFWYADGKN------WSEA---EGGFLPYGVGGVIAGAATCFYAFVGFDSIATSGEEAKNPS 267
            |:.|....|.:.      |.:.   ..||     .|:.|.:....::..|.:.:..:..|||||.
pombe   222 IAAGGVPTDDRGVIGVSYWKQPLVFNNGF-----KGLCAVSVIAIFSLSGTELVGLAASEAKNPQ 281

  Fly   268 VSIPVATVISLFVVTVGYILVSAALTLMIPISEINPAASLP--EAFGQLNLSWAKYLISI----- 325
            .::|.|.....:.:.:.||:....|||::|       :.||  ......|:..:.::|:|     
pombe   282 KTVPAAVKQIFWRIFLFYIVALFMLTLVVP-------SDLPGLRTSDNSNVLISPFVIAIQLANI 339

  Fly   326 -------GALCGMTTTLLG--SLFALPRCMYAMASDGLLFSCFGKIN 363
                   ..:..::|..:|  :.:|..|.::|:|.:|.....|.|.|
pombe   340 RALPSIMNVVILLSTLSVGNSASYAASRALFALAKNGYAPKIFNKTN 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 76/367 (21%)
AA_permease_C 551..601 CDD:290617
meu22NP_596348.1 LysP 17..544 CDD:223903 78/372 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X81
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.