DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and SPCC777.04

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_588250.1 Gene:SPCC777.04 / 2539583 PomBaseID:SPCC777.04 Length:521 Species:Schizosaccharomyces pombe


Alignment Length:474 Identity:115/474 - (24%)
Similarity:175/474 - (36%) Gaps:161/474 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NRCLNTFDIA-LLGIGHMVGAGIYVLTGTVAKEMAGPG-IILSFILAGFISMLAALCYAEFGTRV 98
            :|.:|...:| .:|.|.::|:|..:|.|       ||| :.:::::.|.                
pombe    48 SRHVNMISVAGAIGTGLVIGSGSALLKG-------GPGSLFIAYLMTGI---------------- 89

  Fly    99 PKAGSAYVYTYISMGEFWAFVIGWNILLEHMLGAASVARAWSG----YVDSMLG---GW------ 150
                :.|| ..||:||..||              :|..:.:||    |||..||   ||      
pombe    90 ----NLYV-VLISLGEMAAF--------------SSDDKGFSGFSSRYVDKALGFATGWNYFFKY 135

  Fly   151 --IGNTTLELTG-GIH--EPGLAQYPDVLAFLVCIVYAAAL----AGGVKATAVFNSLLTLVNIA 206
              :..|.|...| .||  .|.|.....|..|||.|:....|    .|.|:.......:|.||.:.
pombe   136 AIVYPTNLTAVGIVIHYWRPDLNVGIWVAVFLVVILAINLLHVKYFGEVEFWLSAVKILVLVTLI 200

  Fly   207 VMVLVIS---------VGFWYADGKNWSEAEGGFLPY---GVGGVIAGAATCF----YAFVGFDS 255
            :..:||:         :||.|     |.: .|.|.||   |..|...|...|.    :|:||.:.
pombe   201 ITCIVITSGGTPVHHKIGFHY-----WRD-PGAFAPYLVEGSTGRFLGFWACLVQSCFAYVGSEV 259

  Fly   256 IATSGEEAKNPSVSIPVATVISLFVVTVGYILVSAALTLMIP---------ISEINPAAS----- 306
            :..:..||.||..:|..::..|||.:...|::....|.|.:|         .|:.|.|||     
pombe   260 VGIAFGEAPNPEKTIRKSSFQSLFRIATFYVIGVFVLGLCVPYDSDILSSNASKGNAAASPFVVA 324

  Fly   307 --------LPEAFGQLNLSWAKYLISIGALCGMTTTLLGSLFALPRCMYAMASDG---------- 353
                    :|:.   :|.....::||    ...:...:||     |.:||:|.:|          
pombe   325 IKLAQIKVMPDV---INACLLVFIIS----SANSDIYIGS-----RTLYALAKEGYAPKILMLQT 377

  Fly   354 ---------LLFSCFGKINPTTQVPLLNLVVSGVMSACLALVFDLAKLVEFMSIGT------LLA 403
                     |:.|.||         ||..:.:...||.:...|..|..|    .||      ||:
pombe   378 KQGIPWVGCLVTSSFG---------LLAFMNTKSSSATIFGYFSSAVTV----FGTINWINILLS 429

  Fly   404 YTIVSASVIILRYRPMERI 422
            |.....:.|:.:. |.|||
pombe   430 YICYHRATIVQQI-PTERI 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 115/474 (24%)
AA_permease_C 551..601 CDD:290617
SPCC777.04NP_588250.1 LysP 1..521 CDD:223903 115/474 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.