DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and SPCPB1C11.02

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_588425.1 Gene:SPCPB1C11.02 / 2539031 PomBaseID:SPCPB1C11.02 Length:505 Species:Schizosaccharomyces pombe


Alignment Length:445 Identity:101/445 - (22%)
Similarity:172/445 - (38%) Gaps:101/445 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGPGIILSFILAGFISMLAALCYAEFGTRVP 99
            |:|.|:...|.:|..|.::|.|:::..|:...|.....:::||.:.|.......|...|....:|
pombe    14 LHRSLSASQIQMLAFGGIIGTGLFLGIGSSLAESGPASLLISFSVLGVSVYCTMLALGEMSVYMP 78

  Fly   100 KAGS--AYVYTYISMGEFWAFVIGWNILLEHMLGAASVARAWSGYVDSMLGGWI----------- 151
            .|||  .||..|:.  |..:|.:.||..|...:..||...|....||.    |:           
pombe    79 VAGSFCTYVGRYVD--EALSFSLTWNYWLNDTIALASHVLATRLVVDF----WLIPTEGDPVSAS 137

  Fly   152 --------------------GNTTLEL--TGGIHEPGLAQYPDVLAFLVCIVYAAALAGGVKATA 194
                                .|..|.:  .||.   |..:|  .|:.:.....||.:..|:    
pombe   138 LSLPPWKEAVRIITPITSLSANIILNMLPVGGF---GEIEY--WLSSIKVFTVAAFIVNGI---- 193

  Fly   195 VFNSLLTLVNIAVMVLVISVGFWYADGKNWSEAEGGFLPYGVGGVIAGAATCFYAFVGFDSIATS 259
                   |.|:.|......:||.|     |.:.  |....|:.|||:......:|:.|.:|||.:
pombe   194 -------LCNLGVNNEKKFIGFRY-----WKDP--GAFNNGIIGVISSFVNAAFAYAGTESIALT 244

  Fly   260 GEEAKNPSVSIPVA------TVISLFVVTVGYILVSAAL-----------TLMIPISEINPAASL 307
            ..|||:|..::|.|      .|:.|::::|  ::|...|           ..|.|.:.:.....:
pombe   245 AGEAKSPITTLPKAIRFTAHRVLLLYIISV--LVVGINLPYNTPGLDGDSVRMSPFTFVFKKFGV 307

  Fly   308 PEAFGQLNLSWAKYLISIGALCGMTTTLLGSLFALPRCMYAMASDGLLFSCFGKINPTTQVPLLN 372
            |.|...:||......:|.|.         .||:|..|.:|::|..|.....|.|.| ...:|.|:
pombe   308 PGAASIMNLVILSSALSAGN---------HSLYAGTRLLYSLAKSGHAPKVFSKCN-KHGIPWLS 362

  Fly   373 LVVSGVMSACLALVFDLAK-----LVEFMSIGTLLAYTIVSASVIILRYRPMERI 422
            ::.:.. :|.|.|:...|.     |:..:::...:::..::.|  .||:|...|:
pombe   363 VLATSA-TAILCLMSSQAGKTWGFLLNVIAVSNQISWIFIAVS--SLRFRKALRV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 101/445 (23%)
AA_permease_C 551..601 CDD:290617
SPCPB1C11.02NP_588425.1 2A0310 16..485 CDD:273334 100/443 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2006
SonicParanoid 1 1.000 - - X81
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.