DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and aat-1

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_501707.1 Gene:aat-1 / 177793 WormBaseID:WBGene00000002 Length:493 Species:Caenorhabditis elegans


Alignment Length:420 Identity:101/420 - (24%)
Similarity:188/420 - (44%) Gaps:52/420 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGPGI-ILSFILAGFISMLAALCYAEFGTRV 98
            |.:.|..|:...:.:|.::|:||:|....|.::....|: ::.::::|..:.:.|.||||.||.:
 Worm    28 LEKSLTLFNGVSMIVGCIIGSGIFVSPTGVQEQAGSVGLSLIVWLISGIFTAIGAYCYAELGTLI 92

  Fly    99 PKAGSAYVYTYISMGEFWAFVIGWNILLEHMLGAASVARAWSGYVDSMLGGWIGNTTLELTGGIH 163
            .|:|..|.|...:.|.|.||:                 |.|   :::::......|.:.||..|:
 Worm    93 KKSGGDYAYIMEAFGPFVAFI-----------------RLW---IEAIVVRPCTVTIVALTFAIY 137

  Fly   164 EPGLAQY------PDV----LAFLVCIVYAAALAGGVKATAVFNSLLTLVNIAVMVLVISVG--- 215
              ||..:      |||    ||.|:.::..|.....|:...:.....|:..:..:.|:|..|   
 Worm   138 --GLRPFFPDCAPPDVVAELLAILLIVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGL 200

  Fly   216 FWYADGKNWSEAEGGFLPYGVGGVIAGAATCFY----AFVGFDSIATSGEEAKNPSVSIPVATVI 276
            .::.:.:.....|..|  ..........:..||    |:.|::.:....||.:||..::|:|..|
 Worm   201 LFFGESQYKDSFENIF--ENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAI 263

  Fly   277 SLFVVTVGYILVSAALTLMIPISEI--NPAASLPEAFGQLNLSWAK--YLISIGALCGMTTTLLG 337
            |:...||.|:|.:.||...|...|:  :||.::..|    |..:.|  :::.:...|....:..|
 Worm   264 SITSCTVIYVLTNVALYTAISPDEMLESPAVAVLFA----NKLYGKFAFIMPLCVACSTIGSANG 324

  Fly   338 SLFALPRCMYAMASDGLLFSCFGKINPTTQVPLLNLVVSGVMS-ACLALVFDLAKLVEFMSIGTL 401
            .:|...|..|:.|.:|.:.:....||..|:.|:..::::|.:| |.|....|:.:|:.::.|...
 Worm   325 VIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYW 389

  Fly   402 LAYTIVSASVIILRYRPMERIHTTIRVPAV 431
            ||.....|::..|| |.|......|:||.:
 Worm   390 LAIGTAIAALFWLR-RTMPDASRPIKVPLI 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 101/420 (24%)
AA_permease_C 551..601 CDD:290617
aat-1NP_501707.1 2A0308 2..491 CDD:273332 101/420 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.