DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and SLC7A13

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_620172.2 Gene:SLC7A13 / 157724 HGNCID:23092 Length:470 Species:Homo sapiens


Alignment Length:416 Identity:99/416 - (23%)
Similarity:168/416 - (40%) Gaps:101/416 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HMVGAGIYVL-TGTVAKEMAGPGIILSFILAG--FISMLAALCYAEFGTRVPKAGSAYVYTYISM 112
            :::||||:|. .|.:|......|:.|. :.||  .::|.:.||.||.....|.:|:.|.:.....
Human    25 NIIGAGIFVSPKGVLAYSCMNVGVSLC-VWAGCAILAMTSTLCSAEISISFPCSGAQYYFLKRYF 88

  Fly   113 GEFWAFVIGWNILLEHMLGAASVARAWSGYVDSMLGGWIGNTTLELTGGIHEPGLAQY------- 170
            |...||:..|..|   .||:..||               |...|          ||:|       
Human    89 GSTVAFLNLWTSL---FLGSGVVA---------------GQALL----------LAEYSIQPFFP 125

  Fly   171 ----PDV----LAFLVCIVYAAALAGGVK-------ATAVFN-SLLTLVNIAVMVLVISVGFWYA 219
                |.:    ||..:..:.....:.|||       |::|.. |:|:.:::..:|.:|.      
Human   126 SCSVPKLPKKCLALAMLWIVGILTSRGVKEVTWLQIASSVLKVSILSFISLTGVVFLIR------ 184

  Fly   220 DGK--------NWSEAEGGFLPYGVGGVIAGAATCFYAFVGFDSIATSGEEAKNPSVSIPVATVI 276
             ||        |..:||...:.:.:..:..|    ::|:.|.........|.|.|..:||.....
Human   185 -GKKENVERFQNAFDAELPDISHLIQAIFQG----YFAYSGGACFTLIAGELKKPRTTIPKCIFT 244

  Fly   277 SLFVVTVGYILVSAA-LTLMIPISEINPAASLPEAFGQLNLSWA-------KYLISIGALCGMTT 333
            :|.:|||.|:||:.: ||::.|...::..|        :.::||       .:::.......:.:
Human   245 ALPLVTVVYLLVNISYLTVLTPREILSSDA--------VAITWADRAFPSLAWIMPFAISTSLFS 301

  Fly   334 TLLGSLFALPRCMYAMASDGLLFSCFGKIN----PTTQVPLLNLVVSGVMSACLALVFDLAKLVE 394
            .||.|:|...|.:|..:.:|.|...|..:|    |.|.|  |.||..|.::..|..:.||...:.
Human   302 NLLISIFKSSRPIYLASQEGQLPLLFNTLNSHSSPFTAV--LLLVTLGSLAIILTSLIDLINYIF 364

  Fly   395 FMSIGTLLAYTIVSASVIILRYRPME 420
            |  .|:|.:..::   :.|||.|..|
Human   365 F--TGSLWSILLM---IGILRRRYQE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 99/416 (24%)
AA_permease_C 551..601 CDD:290617
SLC7A13NP_620172.2 AA_permease_2 16..398 CDD:290254 99/416 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.