DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and Slc7a10

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_446178.2 Gene:Slc7a10 / 114518 RGDID:621672 Length:530 Species:Rattus norvegicus


Alignment Length:406 Identity:99/406 - (24%)
Similarity:173/406 - (42%) Gaps:59/406 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IGHMVGAGIYVLTGTVAKEMAGPGIIL-SFILAGFISMLAALCYAEFGTRVPKAGSAYVYTYISM 112
            ||:::|:||::....|.:.....|:.| .::|.|.::.|.:|||||.|..:||:|..|.|.....
  Rat    56 IGNIIGSGIFISPKGVLEHSGSVGLALFVWVLGGGVTALGSLCYAELGVTIPKSGGDYAYVTEIF 120

  Fly   113 GEFWAFVIGWN-ILLEHMLGAASVARAWSGYVDSMLGGWIGNTTLELTGGIHEPGLAQYPDVLAF 176
            |....|::.|: :|:.:....|.::..:|.||                   .:|         .|
  Rat   121 GGLAGFLLLWSAVLIMYPTSLAVISMTFSNYV-------------------LQP---------VF 157

  Fly   177 LVCIVYAAALAGGVKATAVFNSLLTLVN------------------IAVMVLVISVGFWYADGKN 223
            ..||  ..|.|..|.:.|.. .|||.||                  :..:.|:|:|||......:
  Rat   158 PNCI--PPATASRVLSMACL-MLLTWVNSSSVRWATRIQVIFTGGKLLALSLIITVGFVQIFQGH 219

  Fly   224 WSE-----AEGGFLPYGVGGVIAGAATCFYAFVGFDSIATSGEEAKNPSVSIPVATVISLFVVTV 283
            :.|     |...::...||.:........:||.|::.:....||..:|..::|.|..||:.:||.
  Rat   220 FEELRPTNAFTFWMTPSVGHLALAFLQGSFAFSGWNFLNYVTEELVDPRKNLPRAIFISIPLVTF 284

  Fly   284 GYILVSAA-LTLMIPISEINPAASLPEAFGQLNLSWAKYLISIGALCGMTTTLLGSLFALPRCMY 347
            .|...:.| .|.|.| .|:..:.::...||:..|.:..:::.:.........:.|.||...|..:
  Rat   285 VYTFTNVAYFTAMSP-QELLSSNAVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTSSRLCF 348

  Fly   348 AMASDGLLFSCFGKINPTTQVPLLNLVVSGVMSACLALVFDLAKLVEFMSIGTLLAYTIVSASVI 412
            :.|.:|.|.|....|:.....|:..|:|....:|.:.||.|...|:.::|....|.|.:....::
  Rat   349 SGAREGHLPSFLAMIHVRRCTPIPALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLL 413

  Fly   413 ILRYRPMERIHTTIRV 428
            :||:| ...:|..|:|
  Rat   414 VLRWR-RPALHRPIKV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 99/406 (24%)
AA_permease_C 551..601 CDD:290617
Slc7a10NP_446178.2 2A0308 38..503 CDD:273332 99/406 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.