DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13248 and XB985134

DIOPT Version :9

Sequence 1:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_017950392.2 Gene:XB985134 / 100492274 XenbaseID:XB-GENE-985135 Length:503 Species:Xenopus tropicalis


Alignment Length:423 Identity:107/423 - (25%)
Similarity:188/423 - (44%) Gaps:36/423 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CTKMNRTKSVPTDVMETP---------LNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGPG 72
            |::...|||........|         :.:.:..|:...|.:|:|:|:||:|....|.......|
 Frog     9 CSRKMHTKSKEKRANGGPGKNEPEKMQMKQEITLFNGVSLIVGNMIGSGIFVSPKGVLMYSTSFG 73

  Fly    73 I-ILSFILAGFISMLAALCYAEFGTRVPKAGSAYVYTYISMGEFWAFVIGW-NILLEHMLGAASV 135
            : ::.:.|.|..||..||||||.||.|.|:|::|.|...:.|.|.||:..| ::|:......|.:
 Frog    74 LSLIIWALGGMFSMFGALCYAELGTSVIKSGASYAYILEAFGGFIAFIRLWSSLLIIEPTTQAII 138

  Fly   136 ARAWSGYVDSMLGGWIGNTTLELTGGIHEPGLAQYPDVLAFLVC---IVYAAALAGGVKATAVFN 197
            |..::.|:       :....|..     :|..|....:.|..:|   .:....:..|.:...|| 
 Frog   139 AITFANYI-------VQPIFLSC-----QPPYAAVRLIAAACICTLTFINCVHVRWGTRVQDVF- 190

  Fly   198 SLLTLVNIAVMVLVISVG---FWYADGKNWSEA-EGGFLPYGVGGVIAGAATCFYAFVGFDSIAT 258
               |...|..::::||||   ....:..|.... ||.  ...:|.:.....:..|::.|:|::..
 Frog   191 ---TYAKIMALIMIISVGLAKIVQGESDNLKNPFEGS--TTNIGSMALSLYSALYSYSGWDTLNF 250

  Fly   259 SGEEAKNPSVSIPVATVISLFVVTVGYILVSAALTLMIPISEINPAASLPEAFGQLNLSWAKYLI 323
            ..||.|:|..::|:|..||:.|||:.|:|.:.|...::.:.::..:.::...||...|.:||:||
 Frog   251 VTEEMKHPERNLPLAIAISMPVVTIIYLLTNVAYYAVLDMPDVLASDAVAVTFGNEVLGYAKWLI 315

  Fly   324 SIGALCGMTTTLLGSLFALPRCMYAMASDGLLFSCFGKINPTTQVPLLNLVVSGVMSACLALVFD 388
            .|.........|..|:.|..|..|..|..|.|.:....|:.....|:..|:.:|:::....||.|
 Frog   316 PIAVAMSCYGGLNSSIIAASRLFYVGARQGHLPASLSLIHVENFTPVPALLFNGLIAILYLLVED 380

  Fly   389 LAKLVEFMSIGTLLAYTIVSASVIILRYRPMER 421
            :..|:.:.|....|...:..|.:|:||....:|
 Frog   381 VFLLINYYSFSYWLFVGLSVAGLIVLRITQPQR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13248NP_649219.1 2A0303 32..603 CDD:273330 103/408 (25%)
AA_permease_C 551..601 CDD:290617
XB985134XP_017950392.2 2A0308 13..490 CDD:273332 106/419 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.