DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33969 and UFO1

DIOPT Version :9

Sequence 1:NP_001034034.1 Gene:CG33969 / 40252 FlyBaseID:FBgn0053969 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_013622.1 Gene:UFO1 / 854886 SGDID:S000004553 Length:668 Species:Saccharomyces cerevisiae


Alignment Length:385 Identity:74/385 - (19%)
Similarity:123/385 - (31%) Gaps:132/385 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKDLTIECLLLIFDYCSEGDLLCLCRADPALEYIIEAYYFYPLAYDLLLCG-------HRNN-PR 64
            |:||..|.|:.||.:..|.||..|...         :.:|..|.:|..|..       |..: |.
Yeast     8 LQDLPPEILINIFSHLDEKDLFTLQEL---------STHFRNLIHDEELWKNLFKSRVHTTHFPT 63

  Fly    65 IEQRNRRRLKNYERIELSRNWVSGTYFERPYFHHAQMFPTKLCLEAD-----FLYITHACY---- 120
            ..|.::..::..||.....:|.........|    .:.||:...:..     |.|...|.|    
Yeast    64 FSQSSKFSVEYIERTRGLHHWQHNKAIRTKY----TIIPTRNWDQPSIERIVFDYPRVAAYNDGT 124

  Fly   121 -----LRKYRRSSCDALHRRFDEEI---CTSAQ-TDISDFVKKNETIFA---GRVCGSCF---HY 170
                 |:.::|      .::|.:.|   ||:.| ....|| ..|..:|.   |||.|...   .|
Yeast   125 ITILQLQNHKR------QKKFKKLIYIPCTTPQGCSTMDF-NINAAVFGRFDGRVFGKLLSNKSY 182

  Fly   171 DTDSMVMTEQRMHPANEYLYCVDFVKDLYATSTDHCCRLWQRAQEFGMTHFDQVMHLPHAFRSLE 235
            .|..|..|.:  |.|.....|..              ..|..::|                    
Yeast   183 LTPVMEFTGR--HSAGVTAICNS--------------ESWDTSRE-------------------- 211

  Fly   236 LSSDGQWLYGGLYTDNGRQALRAVHVESGEELVF--SSKTMSIYDLKLKDDQVIFTANF--DSTF 296
                 .|...|  ::||             |:::  .:|.:.::.:   .::||:...|  |.|.
Yeast   212 -----DWSVSG--SENG-------------EIIWWCENKLVKMWKV---SNRVIWKLAFFKDWTL 253

  Fly   297 RMFDRR------------VDRDVAIWDDPFDSSFYSLEYDGLHAVLVGTNRHARVNLYDI 344
            .|.|.:            :|....:.:.|....|:.:::..:..||...|     |:|.|
Yeast   254 IMDDEKLYIIHQMQELHSIDIPKDLDEQPMRVRFFKMDFGSMTLVLADLN-----NVYTI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33969NP_001034034.1 WD40 <146..345 CDD:225201 39/221 (18%)
WD40 183..391 CDD:295369 27/178 (15%)
UFO1NP_013622.1 F-box-like 8..52 CDD:403981 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.