DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33969 and FBXW4

DIOPT Version :9

Sequence 1:NP_001034034.1 Gene:CG33969 / 40252 FlyBaseID:FBgn0053969 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_071322.2 Gene:FBXW4 / 6468 HGNCID:10847 Length:567 Species:Homo sapiens


Alignment Length:350 Identity:81/350 - (23%)
Similarity:136/350 - (38%) Gaps:69/350 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ERIELSRNWVSGTYFE----------RPYFHHAQMFPTKLCLEADFLYITHACYLRKYR-RSSCD 130
            ||:::|:||..|...|          .|:..          ||.|.|||:.|.::..|: |....
Human   250 ERVKVSQNWRLGRCREGILLKWRCSQMPWMQ----------LEDDSLYISQANFILAYQFRPDGA 304

  Fly   131 ALHRR-------FDEEICTSAQTDISDFVKKNETIFAGRVCGSCFHYDTDSMVMTEQRMHPANEY 188
            :|:||       .||::|        .||..|..|.:....|....:...|....:...|  .:.
Human   305 SLNRRPLGVFAGHDEDVC--------HFVLANSHIVSAGGDGKIGIHKIHSTFTVKYSAH--EQE 359

  Fly   189 LYCVDFVKDLYAT-STDHCCRLWQRAQEFGMTHFDQVMHLPHAFRSLELSSDGQW------LYGG 246
            :.|||....:..: |.|...::|..|.    ....|.:|...       :.|..|      |...
Human   360 VNCVDCKGGIIVSGSRDRTAKVWPLAS----GRLGQCLHTIQ-------TEDRVWSIAISPLLSS 413

  Fly   247 LYTDNG----RQALRAVHVESGEELVFSSKTM----SIYDLKLKDDQVIFTANFDSTFRMFDRR- 302
            ..|...    ...||...:.||:.:.......    .:.|:..:....:.:..:|:..|.:|.| 
Human   414 FVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYDTYVRYWDLRT 478

  Fly   303 -VDRDVAIWDDPFDSSFYSLEYDGLHAVLVGTNRHARVNLYDIRMKKYVQLYFPGRTRSHNGLSP 366
             |.:.|..|::|.||:.|.|:.||.|.:..|::.:..|.|:|.|.:..:.. ||  ..|....||
Human   479 SVRKCVMEWEEPHDSTLYCLQTDGNHLLATGSSYYGVVRLWDRRQRACLHA-FP--LTSTPLSSP 540

  Fly   367 VYSLACDSQYMFVATDHNMRVFDFK 391
            ||.|...:::::.|..:|:.|.||:
Human   541 VYCLRLTTKHLYAALSYNLHVLDFQ 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33969NP_001034034.1 WD40 <146..345 CDD:225201 44/215 (20%)
WD40 183..391 CDD:295369 51/224 (23%)
FBXW4NP_071322.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152585
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28NFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5355
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49778
OrthoDB 1 1.010 - - D320419at33208
OrthoFinder 1 1.000 - - FOG0008136
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108554
Panther 1 1.100 - - LDO PTHR14381
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.