DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5498 and CHMP4C

DIOPT Version :9

Sequence 1:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_689497.1 Gene:CHMP4C / 92421 HGNCID:30599 Length:233 Species:Homo sapiens


Alignment Length:207 Identity:46/207 - (22%)
Similarity:84/207 - (40%) Gaps:15/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 QAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRKRHLLEKNHERRSLALH 308
            :|:..|:.|:..|.|:.|.||..|:......:::..:|||...:...||:. .||...:....|.
Human    24 EALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKR-FEKQLTQIDGTLS 87

  Fly   309 NIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSGLKYDNVDEVLADVRDTLDQHREVQDIMS 373
            .||....:::.:..:..||......:..:|.|..|..|  :.:|:::.::.:..|..:|:.:..|
Human    88 TIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDL--NKIDDLMQEITEQQDIAQEISEAFS 150

  Fly   374 NSVVENASQEDDQLEQELRELAGE------------SAPATFSPHINNNLRAEVVITDEEMIAML 426
            ..|......::|:|..||.||..|            :.|::..|...|..............|..
Human   151 QRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASS 215

  Fly   427 QDLEVEDGTVSQ 438
            |..|.||..:.|
Human   216 QRAEEEDDDIKQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5498NP_730525.2 Snf7 244..397 CDD:304451 36/152 (24%)
CHMP4CNP_689497.1 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 1..153 29/131 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 46/207 (22%)
Snf7 24..190 CDD:308778 37/168 (22%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 154..233 16/74 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..233 10/55 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.