Sequence 1: | NP_730525.2 | Gene: | CG5498 / 40250 | FlyBaseID: | FBgn0027565 | Length: | 448 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689497.1 | Gene: | CHMP4C / 92421 | HGNCID: | 30599 | Length: | 233 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 46/207 - (22%) |
---|---|---|---|
Similarity: | 84/207 - (40%) | Gaps: | 15/207 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 QAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRKRHLLEKNHERRSLALH 308
Fly 309 NIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSGLKYDNVDEVLADVRDTLDQHREVQDIMS 373
Fly 374 NSVVENASQEDDQLEQELRELAGE------------SAPATFSPHINNNLRAEVVITDEEMIAML 426
Fly 427 QDLEVEDGTVSQ 438 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5498 | NP_730525.2 | Snf7 | 244..397 | CDD:304451 | 36/152 (24%) |
CHMP4C | NP_689497.1 | Intramolecular interaction with C-terminus. /evidence=ECO:0000250 | 1..153 | 29/131 (22%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | 46/207 (22%) | |||
Snf7 | 24..190 | CDD:308778 | 37/168 (22%) | ||
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 | 154..233 | 16/74 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 173..233 | 10/55 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22761 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |