DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5498 and Chmp4b

DIOPT Version :9

Sequence 1:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_083638.1 Gene:Chmp4b / 75608 MGIID:1922858 Length:224 Species:Mus musculus


Alignment Length:180 Identity:47/180 - (26%)
Similarity:80/180 - (44%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 QAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRKRHLLEKNHERRSLALH 308
            :|:..|::|:..|.|:.|.||::|:......:::..:|||...:...||     |.:|::   |.
Mouse    24 EAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRK-----KRYEKQ---LA 80

  Fly   309 NIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSG------------LKYDNVDEVLADVRDT 361
            .|:..||:: |.|...:.      .:||..:||.|.|            :..|.|||::.|:.|.
Mouse    81 QIDGTLSTI-EFQREALE------NANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQ 138

  Fly   362 LDQHREVQDIMSNSVVENASQEDDQLEQELRELAGE---------SAPAT 402
            .:...|:...:|..|......::|:|..||.||..|         |.|.|
Mouse   139 QELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPET 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5498NP_730525.2 Snf7 244..397 CDD:304451 43/164 (26%)
Chmp4bNP_083638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Intramolecular interaction with C-terminus. /evidence=ECO:0000250 2..153 36/143 (25%)
Snf7 24..198 CDD:397437 47/180 (26%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 154..224 10/35 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..224 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.