DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5498 and chmp4ba

DIOPT Version :9

Sequence 1:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_956489.1 Gene:chmp4ba / 393164 ZFINID:ZDB-GENE-040426-906 Length:220 Species:Danio rerio


Alignment Length:215 Identity:51/215 - (23%)
Similarity:92/215 - (42%) Gaps:49/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 QAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRKRHLLEKNHERRSLALH 308
            :|:..|:.|:..|.|:.|.||::|:......::...:|||...:...||     |.:|::   |.
Zfish    22 EAIQRLRETEEMLTKKQEFLEKKIEQELVTAKKNGTKNKRAALQALKRK-----KRYEKQ---LA 78

  Fly   309 NIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSG------------LKYDNVDEVLADVRDT 361
            .|:..||:: |.|...:.      .::|..:|:.|.|            :..|.|||::.|:.:.
Zfish    79 QIDGTLSTI-EFQREALE------NAHTNTEVIKNMGYAAKAMKAAHDNMDIDKVDELMQDIIEQ 136

  Fly   362 LDQHREVQDIMSNSVVENASQEDDQLEQELRELAGE----------------SAPATFSPHINNN 410
            .:..:|:.|.:|..|......::|:|..||.||..|                :.|:|..|.....
Zfish   137 QELAQEISDAISKPVGFGEEFDEDELLAELEELEQEELDKNLLEIGDNVPLPNVPSTSLPSRPAK 201

  Fly   411 LRAEVVITDEEMIAMLQDLE 430
            .:.|   .||:   .::|||
Zfish   202 KKEE---EDED---DMKDLE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5498NP_730525.2 Snf7 244..397 CDD:304451 41/164 (25%)
chmp4baNP_956489.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 51/215 (24%)
Snf7 22..157 CDD:281366 35/149 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..220 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.