DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5498 and Vps20

DIOPT Version :9

Sequence 1:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_611686.2 Gene:Vps20 / 37581 FlyBaseID:FBgn0034744 Length:212 Species:Drosophila melanogaster


Alignment Length:198 Identity:51/198 - (25%)
Similarity:97/198 - (48%) Gaps:11/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 KIPKKPGDDLNISQEDQAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRK 292
            |..||.... .|:.:|:||..|:..:.:|.:..:.:|.:::.:....|:.:::.::..||..|||
  Fly     7 KTSKKTAPS-RITDQDKAVLQLKQQRDRLKQYQKRIETQLENDRLLARKCLQQGRKDRAKLLLRK 70

  Fly   293 RHLLEKNHERRSLALHNIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSGLKYDNVDEVLAD 357
            :...|.........|.|:|.|.:.::.||....|||..|.|:..||||  :..|..|.|:.::.:
  Fly    71 KKYQESLLTNADKQLENLEKLAADIEFAQVEMKVLDGLKAGNAALKKV--HEMLDIDEVERIMDE 133

  Fly   358 VRDTLDQHREVQDIMSNSVVENASQED-----DQLEQELRELAGESAPATFSPHINNNLRAEVVI 417
            .|:.:::.:|:..|::: |:....:||     |.||.|..:..|...|..  |..:..:.||:..
  Fly   134 TREGIEKQQEIDAILTD-VLTTQDEEDVLAELDALEAEEEQQKGAQLPDV--PTEDLPIPAEIES 195

  Fly   418 TDE 420
            .:|
  Fly   196 VEE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5498NP_730525.2 Snf7 244..397 CDD:304451 40/157 (25%)
Vps20NP_611686.2 Snf7 22..186 CDD:281366 43/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.