DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5498 and shrb

DIOPT Version :10

Sequence 1:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster


Alignment Length:155 Identity:48/155 - (30%)
Similarity:83/155 - (53%) Gaps:3/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 QAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRKRHLLEKNHERRSLALH 308
            :|:..|:.|:..|:|:.|.||.:|:...:..|:...:||| :|...|:|:..|||..::....|.
  Fly    20 EAIQKLRETENMLIKKQEFLEAKIEDELNIARKNASKNKR-VALQALKKKKRLEKQLQQIDGTLS 83

  Fly   309 NIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSGLKYDNVDEVLADVRDTLDQHREVQDIMS 373
            .||....:::.|..:..||...|..::.||:...|  :..|.|.:::.|:.:..|..||:.|.:|
  Fly    84 TIEMQREALESANTNTAVLTTMKNAADALKRAHQN--MDVDKVHDMMDDIAEQQDVAREISDAIS 146

  Fly   374 NSVVENASQEDDQLEQELRELAGES 398
            |.|...|..:|:.||:||.||..|:
  Fly   147 NPVAFGADLDDEDLERELDELEQEN 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5498NP_730525.2 Snf7 244..397 CDD:460896 47/152 (31%)
shrbNP_610462.3 Snf7 20..193 CDD:460896 48/155 (31%)

Return to query results.
Submit another query.