DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5498 and CHMP4A

DIOPT Version :10

Sequence 1:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_054888.3 Gene:CHMP4A / 29082 HGNCID:20274 Length:222 Species:Homo sapiens


Alignment Length:207 Identity:48/207 - (23%)
Similarity:94/207 - (45%) Gaps:28/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 DQAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRKRHLLEKNHERRSLAL 307
            ::|:..|:.|:..|:|:.|.||::|:......::|..:||| .|...||::...|:...:....|
Human    20 EEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKR-AALQALRRKKRFEQQLAQTDGTL 83

  Fly   308 HNIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSGLKYDNVDEVLADVRDTLDQHREVQDIM 372
            ..:|....:::.|..:..||...::.:.::||...:  :..|.|||::.|:.:..:..:::.|.:
Human    84 STLEFQREAIENATTNAEVLRTMELAAQSMKKAYQD--MDIDKVDELMTDITEQQEVAQQISDAI 146

  Fly   373 SNSVVENASQEDDQLEQELRELAGE---------------------SAPATFSPHINNNLRAEVV 416
            |..:......::|:|.:||.||..|                     |.|:|..|    ...|..|
Human   147 SRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLP----AGPAPKV 207

  Fly   417 ITDEEMIAMLQD 428
            ..|||.:..|.:
Human   208 DEDEEALKQLAE 219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5498NP_730525.2 Snf7 244..397 CDD:460896 37/152 (24%)
CHMP4ANP_054888.3 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 1..150 31/132 (23%)
Interaction with phosphoinosides 1..116 23/96 (24%)