DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5498 and R12C12.5

DIOPT Version :9

Sequence 1:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_495206.2 Gene:R12C12.5 / 174010 WormBaseID:WBGene00020025 Length:236 Species:Caenorhabditis elegans


Alignment Length:171 Identity:47/171 - (27%)
Similarity:86/171 - (50%) Gaps:16/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 DQAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRKRHLLEKNHERRSLAL 307
            |:|:.||::.:..|:|:.|..|..|:...:..::|||.||: ||...|||:...|:...|....|
 Worm    37 DEAIGNLRDAEELLIKKQEYFELRIEQEVESAKKYMKTNKK-MALAALRKKKHYEQELSRIDGVL 100

  Fly   308 HNIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSGLKYDNVDEVLADVRDTLDQHREVQDIM 372
            ..:|:..::::.......|:|.....:.||||  .::.:..|.|.:::.::.|.|....|:.:.:
 Worm   101 TKLEAQRTALENVGMHNEVIDVLGKTTETLKK--EHAKMDIDKVHDLMDEIADGLAMSEELNEAI 163

  Fly   373 SNSVVENASQEDDQLEQELRELAGESA-----------PAT 402
            |..:.:.|  ::|:|.|||:||....|           |||
 Worm   164 SAPIGDVA--DEDELMQELQELQDNVADLSTTTKLPDVPAT 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5498NP_730525.2 Snf7 244..397 CDD:304451 42/152 (28%)
R12C12.5NP_495206.2 Snf7 38..202 CDD:281366 44/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.