Sequence 1: | NP_001262107.1 | Gene: | RhoBTB / 40249 | FlyBaseID: | FBgn0036980 | Length: | 783 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014309.3 | Gene: | RHO2 / 855634 | SGDID: | S000005034 | Length: | 192 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 207 | Identity: | 68/207 - (32%) |
---|---|---|---|
Similarity: | 111/207 - (53%) | Gaps: | 37/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 KCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWA--IDQYRIYKDVLERSWEVVDGVNV 77
Fly 78 SLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCK 140
Fly 141 NDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGV-AYYETSVFTYFGVNEVFE 204
Fly 205 NAIRSALIARRQ 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoBTB | NP_001262107.1 | RhoBTB | 12..210 | CDD:133275 | 67/199 (34%) |
RHO | 16..211 | CDD:197554 | 66/199 (33%) | ||
BTB | <392..446 | CDD:295341 | |||
BTB | 481..575 | CDD:279045 | |||
BTB | 485..582 | CDD:197585 | |||
RHO2 | NP_014309.3 | Rho2 | 7..191 | CDD:206702 | 68/207 (33%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |