DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and RHO4

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_012981.3 Gene:RHO4 / 853929 SGDID:S000001763 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:72/219 - (32%)
Similarity:111/219 - (50%) Gaps:52/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KMDNEQPHQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLST----HVPTVWAIDQYRIYKD 63
            |..|:.|...| |.|:|||.|||||.|:          :|.:..|    ::||::          
Yeast    63 KRTNKLPDYHL-KIVVVGDGAVGKTCLL----------ISYVQGTFPTDYIPTIF---------- 106

  Fly    64 VLERSWEVVDGVN---VSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYP 123
              |.....::|.|   :.|.||||.|  ::.:.|..:|..:||:::|:|:.|..||:|.:.:|:|
Yeast   107 --ENYVTNIEGPNGQIIELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFP 169

  Fly   124 EIRRFCPDVPVILVGCKNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGV-A 187
            |::.|||..|::|||.|:||   |..:|.                ||||.|..|.::||.||. |
Yeast   170 EVKHFCPSTPIMLVGLKSDL---YEADNL----------------SDLVEPSSAESLAKRLGAFA 215

  Fly   188 YYETSVFTYFGVNEVFENAIRSAL 211
            :.:.|......::||||.||.:.|
Yeast   216 HIQCSARLKENIDEVFETAIHTLL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 68/207 (33%)
RHO 16..211 CDD:197554 66/204 (32%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
RHO4NP_012981.3 Rho4_like 70..248 CDD:206704 69/212 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.