DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and RAC3

DIOPT Version :10

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_195228.1 Gene:RAC3 / 829654 AraportID:AT4G35020 Length:198 Species:Arabidopsis thaliana


Alignment Length:219 Identity:74/219 - (33%)
Similarity:106/219 - (48%) Gaps:38/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVS 78
            :|||.|||.|||||.|:.:...|      ...:.:||||:  |.:        .:..:|||..::
plant     7 IKCVTVGDGAVGKTCLLISYTSN------TFPTDYVPTVF--DNF--------SANVIVDGNTIN 55

  Fly    79 LRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKN 141
            |.||||.|  |:::.|..:|..:||.||.||:.|..|..|....|.||:|.:.|.||:||||.|.
plant    56 LGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKL 120

  Fly   142 DLRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGV-AYYETSVFTYFGVNEVFEN 205
            ||    ||:.  .:|.|....|.       :...:...:.|.:|. ||.|.|..|...|..||:.
plant   121 DL----RDDK--QFFAEHPGAVP-------ISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDA 172

  Fly   206 AIRSALIARRQQRFWMTNLKKVQK 229
            ||:..|...:.::      ||.:|
plant   173 AIKVVLQPPKNKK------KKKRK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 70/198 (35%)
BTB1_POZ_RhoBTB 255..452 CDD:349608
BTB2_POZ_RhoBTB 475..582 CDD:349609
BACK_RHOBTB 593..669 CDD:350574
RAC3NP_195228.1 Rop_like 6..178 CDD:206705 70/199 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.