DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and ROP9

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_194624.1 Gene:ROP9 / 829016 AraportID:AT4G28950 Length:209 Species:Arabidopsis thaliana


Alignment Length:210 Identity:73/210 - (34%)
Similarity:107/210 - (50%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEV-VDGV 75
            :.:|||.|||.|||||.::.....||      ..:.::|||:  |.:         |..| |||.
plant     5 KFIKCVTVGDGAVGKTCMLICYTSNK------FPTDYIPTVF--DNF---------SANVAVDGQ 52

  Fly    76 NVSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVG 138
            .|:|.||||.|  |:.:.|..:|..:|:.:|.||:.|..|..|....|.||:|||.|:||::|||
plant    53 IVNLGLWDTAGQEDYSRLRPLSYRGADIFVLAFSLISKASYENVLKKWMPELRRFAPNVPIVLVG 117

  Fly   139 CKNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELG-VAYYETSVFTYFGVNEV 202
            .|.|||   .|:.||            |..::::...:...:.|::| .||.|.|..|...|..|
plant   118 TKLDLR---DDKGYL------------ADHTNVITSTQGEELRKQIGAAAYIECSSKTQQNVKAV 167

  Fly   203 FENAIRSALIARRQQ 217
            |:.||:..|...|::
plant   168 FDTAIKVVLQPPRRK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 71/201 (35%)
RHO 16..211 CDD:197554 70/198 (35%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
ROP9NP_194624.1 Rop_like 6..176 CDD:206705 71/201 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.