DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and ROP9

DIOPT Version :10

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_194624.1 Gene:ROP9 / 829016 AraportID:AT4G28950 Length:209 Species:Arabidopsis thaliana


Alignment Length:105 Identity:22/105 - (20%)
Similarity:38/105 - (36%) Gaps:31/105 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 HQRKA--FIWDLNFIKVFMESEL--------GKAQDE---IKELKAELDYERKARRRAELMIKKL 108
            |:.|:  |....||  .|.|..|        ||.:::   :.:|....|:.|..           
plant   205 HELKSCPFPRKCNF--CFQEGHLYAGCPQRNGKPKEDTVVLGKLPVPADFSRSL----------- 256

  Fly   109 AKDVEEERMAREAEEMQNKRLFKELSSEKSEMVRMKRDLE 148
               .|||....:.|.:..::  ||...:||..:.:...:|
plant   257 ---TEEEGEVSQEEHVVKRK--KEKKEKKSVDIEVSPSME 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 22/105 (21%)
BTB1_POZ_RhoBTB 255..452 CDD:349608
BTB2_POZ_RhoBTB 475..582 CDD:349609
BACK_RHOBTB 593..669 CDD:350574
ROP9NP_194624.1 Rop_like 6..176 CDD:206705
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.