DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and ROP1

DIOPT Version :10

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_190698.1 Gene:ROP1 / 824293 AraportID:AT3G51300 Length:197 Species:Arabidopsis thaliana


Alignment Length:162 Identity:39/162 - (24%)
Similarity:77/162 - (47%) Gaps:36/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DLNFIKVFMESELGKAQDEIK---------------------ELKAELDYERKARR-RAELMIKK 107
            ::||::...|:|:.:.|.:|.                     |:||:  ||..|.| |||.....
plant   260 EVNFLRTMFEAEIAQLQGQISDTSVIVSMDNNRNLDLDGIIAEVKAQ--YEEIANRSRAEAESWY 322

  Fly   108 LAKDVEEERM--AREAEEMQNKRLFKELSSEKSEMVRMKRDLEE-ERQMHRLAEVL--REERVQM 167
            .:| .||.|:  .|..::::|.:  .|::.....:.|::.::|. ..|..:|...:  .|||.:|
plant   323 QSK-YEELRLTAGRNGDDLRNTK--NEVADLNRMINRLRGEIETVNAQRGKLEGAITEAEERGEM 384

  Fly   168 KLMDARLFLEEKLSELEEANRQGERERNRMMK 199
            ...||:    :||::|||..::.:::..|.::
plant   385 ATKDAK----KKLADLEEGLQKAKQDMARQLR 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 39/162 (24%)
BTB1_POZ_RhoBTB 255..452 CDD:349608
BTB2_POZ_RhoBTB 475..582 CDD:349609
BACK_RHOBTB 593..669 CDD:350574
ROP1NP_190698.1 Rop_like 6..178 CDD:206705
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.