DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and ARAC9

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_566024.1 Gene:ARAC9 / 819077 AraportID:AT2G44690 Length:209 Species:Arabidopsis thaliana


Alignment Length:202 Identity:72/202 - (35%)
Similarity:104/202 - (51%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVS 78
            :|||.|||.|||||.|:.:...|      ...:.:||||:  |.:.  .:||      |||..|:
plant    19 IKCVTVGDGAVGKTCLLISYTSN------TFPTDYVPTVF--DNFN--ANVL------VDGKTVN 67

  Fly    79 LRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKN 141
            |.||||.|  |:::.|..:|..:||.:|.||:.|..|..|....|.||:|.:.|.||::|||.|:
plant    68 LGLWDTAGQEDYNRVRPLSYRGADVFILAFSLISRPSFENIAKKWVPELRHYAPTVPIVLVGTKS 132

  Fly   142 DLR-YMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELG-VAYYETSVFTYFGVNEVFE 204
            ||| .|...:||..              :..:.|::.:.:.||:| :||.|.|......|..||:
plant   133 DLRDNMQFPKNYPG--------------ACTIFPEQGQELRKEIGALAYIECSSKAQMNVKAVFD 183

  Fly   205 NAIRSAL 211
            .||:..|
plant   184 EAIKVVL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 71/199 (36%)
RHO 16..211 CDD:197554 70/198 (35%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
ARAC9NP_566024.1 Rop_like 18..190 CDD:206705 71/200 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.