DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and RND2

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:XP_011523618.1 Gene:RND2 / 8153 HGNCID:18315 Length:234 Species:Homo sapiens


Alignment Length:238 Identity:72/238 - (30%)
Similarity:114/238 - (47%) Gaps:36/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVSL 79
            |.|:|||...|||.|:...|.:.:.      .::||||:  :.|       ..|:| :|...:.|
Human     9 KIVVVGDAECGKTALLQVFAKDAYP------GSYVPTVF--ENY-------TASFE-IDKRRIEL 57

  Fly    80 RLWDTFGD--HDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKND 142
            .:|||.|.  :|..|..||..||.||:||.|:.|.:|.:....|..|.:.|||:..|:|||||.|
Human    58 NMWDTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLD 122

  Fly   143 LRYMYRDENYLSYFGEKGTFVRAALKSDL--VMPDEARAVAKELG-VAYYE-TSVFTYFGVNEVF 203
            :|            .:..| :|...|..|  |..::...:||::| |:|.| :|..:...|.:||
Human   123 MR------------TDLAT-LRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVF 174

  Fly   204 ENAIRSALIARRQQRFWMTNLKKVQKPLLQAPFRPPKPPPPEV 246
            ..|..::| .|..::...|:.::..:...|...||.:....|:
Human   175 HVATVASL-GRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 65/200 (33%)
RHO 16..211 CDD:197554 64/200 (32%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
RND2XP_011523618.1 Rnd2_Rho7 7..227 CDD:206736 72/238 (30%)
RHO 10..182 CDD:197554 64/200 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.