DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and Rnd3

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_083086.1 Gene:Rnd3 / 74194 MGIID:1921444 Length:244 Species:Mus musculus


Alignment Length:263 Identity:77/263 - (29%)
Similarity:119/263 - (45%) Gaps:59/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PHQELVKC--VLVGDTAVGKTRL--ICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSW 69
            |:|. |||  |:|||:..|||.|  :.|:.|        ....:||||:  :.|       ..|:
Mouse    18 PNQN-VKCKIVVVGDSQCGKTALLHVFAKDC--------FPENYVPTVF--ENY-------TASF 64

  Fly    70 EVVDGVNVSLRLWDTFGD--HDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDV 132
            | :|...:.|.||||.|.  :|..|..:|..||.||:||.|:.|.:|.:....|..||:.|||:.
Mouse    65 E-IDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNT 128

  Fly   133 PVILVGCKNDLRYMYRDENYLSYFGEKGTFVRAA-LKSDLVMPDEARAVAKELGVA-YYETSVFT 195
            .::|||||:|||            .:..|.|..: .:...|..|:...:||::|.| |.|.|...
Mouse   129 KMLLVGCKSDLR------------TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQ 181

  Fly   196 YFGVNEVFENAIRS-------ALIARRQQRFWMTNLKKVQKPLLQAPFRPPKPPPPEVTVMVGNY 253
                   .||::|.       |.:.:..:.......::..|.:...|.|      ||::.:..:.
Mouse   182 -------SENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSR------PELSAVATDL 233

  Fly   254 RQD 256
            |:|
Mouse   234 RKD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 67/212 (32%)
RHO 16..211 CDD:197554 65/209 (31%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
Rnd3NP_083086.1 Rnd3_RhoE_Rho8 19..200 CDD:206735 69/218 (32%)
Effector region. /evidence=ECO:0000255 52..60 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.