Sequence 1: | NP_001262107.1 | Gene: | RhoBTB / 40249 | FlyBaseID: | FBgn0036980 | Length: | 783 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598716.1 | Gene: | Rhou / 69581 | MGIID: | 1916831 | Length: | 261 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 76/202 - (37%) |
---|---|---|---|
Similarity: | 104/202 - (51%) | Gaps: | 40/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 VKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVS 78
Fly 79 LRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKN 141
Fly 142 DLRYMYRDENYLSYFGEKGTFVRAALKSDLV----MPDE-ARAVAKEL-GVAYYETSVFTYFGVN 200
Fly 201 EVFENAI 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoBTB | NP_001262107.1 | RhoBTB | 12..210 | CDD:133275 | 76/202 (38%) |
RHO | 16..211 | CDD:197554 | 74/200 (37%) | ||
BTB | <392..446 | CDD:295341 | |||
BTB | 481..575 | CDD:279045 | |||
BTB | 485..582 | CDD:197585 | |||
Rhou | NP_598716.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..48 | ||
Wrch_1 | 53..225 | CDD:133330 | 76/202 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |