| Sequence 1: | NP_001262107.1 | Gene: | RhoBTB / 40249 | FlyBaseID: | FBgn0036980 | Length: | 783 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_067028.1 | Gene: | RHOU / 58480 | HGNCID: | 17794 | Length: | 258 | Species: | Homo sapiens |
| Alignment Length: | 202 | Identity: | 75/202 - (37%) |
|---|---|---|---|
| Similarity: | 102/202 - (50%) | Gaps: | 40/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 VKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVS 78
Fly 79 LRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKN 141
Fly 142 DLRYMYRDENYLSYFGEKGTFVRAALKSDLV----MPDE-ARAVAKELGVA-YYETSVFTYFGVN 200
Fly 201 EVFENAI 207 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RhoBTB | NP_001262107.1 | RhoBTB | 12..210 | CDD:133275 | 75/202 (37%) |
| RHO | 16..211 | CDD:197554 | 73/200 (37%) | ||
| BTB | <392..446 | CDD:295341 | |||
| BTB | 481..575 | CDD:279045 | |||
| BTB | 485..582 | CDD:197585 | |||
| RHOU | NP_067028.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..45 | ||
| Wrch_1 | 50..222 | CDD:133330 | 75/202 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||