DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and rhof

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001018478.1 Gene:rhof / 573655 ZFINID:ZDB-GENE-050522-280 Length:209 Species:Danio rerio


Alignment Length:219 Identity:69/219 - (31%)
Similarity:104/219 - (47%) Gaps:44/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDG 74
            |.:.:|.|:|||...|||.|:...|      .......:.|:|:  |:|     |...|:   .|
Zfish    13 HADALKIVIVGDGGCGKTSLLMVYA------KGDFPEKYAPSVF--DKY-----VTTVSY---GG 61

  Fly    75 VNVSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILV 137
            .::.|.|:||.|  |:|:.|..:|...::||:|:.:.:|.|..|.|:.||||:|.||.|.|:||:
Zfish    62 KDIQLNLYDTAGQEDYDRLRPLSYQDVNIVLICYDVTNPTSFDNVKIKWYPEVRHFCRDAPIILI 126

  Fly   138 GCKNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEA-------RAVAKELGV-AYYETSVF 194
            .||.|||   :|:       ||...::|.        |:|       ....||:.. .|.|.|..
Zfish   127 SCKTDLR---KDK-------EKMRRLKAL--------DQAPITYLLGEQTQKEMNAEIYLECSAK 173

  Fly   195 TYFGVNEVFENAIRSALIARRQQR 218
            ....|.::|..|.:.||.||.:.|
Zfish   174 YRENVEDIFREATKRALAARAKAR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 63/207 (30%)
RHO 16..211 CDD:197554 62/204 (30%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
rhofNP_001018478.1 P-loop_NTPase 17..209 CDD:304359 68/215 (32%)
RHO 19..186 CDD:197554 61/200 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.