DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and rhof

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001016369.1 Gene:rhof / 549123 XenbaseID:XB-GENE-920536 Length:218 Species:Xenopus tropicalis


Alignment Length:231 Identity:66/231 - (28%)
Similarity:102/231 - (44%) Gaps:58/231 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVS 78
            ||.|:|||...|||.|:...|           ....|..:|...:..|...:     .:...::.
 Frog    26 VKIVIVGDGGCGKTSLLMVYA-----------KGSFPEQYAPSVFEKYTTTI-----TIGNKDIF 74

  Fly    79 LRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKN 141
            |.|:||.|  |:|:.|..:|...::||:|:.:.:|.|..|..:.||||:..||..||::|:|||.
 Frog    75 LHLYDTAGQEDYDRLRPLSYQDVNLVLICYDVTNPTSFDNVLIKWYPEVHHFCRGVPIVLIGCKT 139

  Fly   142 DLRYMYRDENYL-----------SYF-GEKGTFVRAALKSDLVMPDEARAVAKELGVAYYETSVF 194
            |||   :|:..|           :|| ||                |..:::.   ...|.|.|..
 Frog   140 DLR---KDKERLRKLRTAQQEPVTYFQGE----------------DTCKSIQ---AAEYLECSAK 182

  Fly   195 TYFGVNEVFENAIRSALIA-RRQQRFWMTNLKKVQK 229
            ....::.||:.|...||.| :|:|:     ||:.||
 Frog   183 YRENIDNVFKEATLIALNAMKREQK-----LKRKQK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 57/209 (27%)
RHO 16..211 CDD:197554 55/208 (26%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
rhofNP_001016369.1 Rho4_like 23..218 CDD:206704 66/231 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.