DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and rac1

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001004840.1 Gene:rac1 / 448118 XenbaseID:XB-GENE-489008 Length:192 Species:Xenopus tropicalis


Alignment Length:217 Identity:82/217 - (37%)
Similarity:118/217 - (54%) Gaps:40/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVN 76
            :.:|||:|||.|||||.|:.:...|      .....::|||:  |.|.  .:|:      |||..
 Frog     2 QAIKCVVVGDGAVGKTCLLISYTTN------AFPGEYIPTVF--DNYS--ANVM------VDGKP 50

  Fly    77 VSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGC 139
            |:|.||||.|  |:|:.|..:|.::||.|:|||:.||.|..|.:..||||:|..||:.|:||||.
 Frog    51 VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGT 115

  Fly   140 KNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMP---DEARAVAKELG-VAYYETSVFTYFGVN 200
            |.|||            .:|.|..:  ||...:.|   .:..|:|||:| |.|.|.|..|..|:.
 Frog   116 KLDLR------------DDKDTIEK--LKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLK 166

  Fly   201 EVFENAIRSAL----IARRQQR 218
            .||:.|||:.|    :.:|:::
 Frog   167 TVFDEAIRAVLCPPPVKKRKRK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 80/203 (39%)
RHO 16..211 CDD:197554 79/200 (40%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
rac1NP_001004840.1 Rac1_like 3..176 CDD:206663 80/202 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.