Sequence 1: | NP_001262107.1 | Gene: | RhoBTB / 40249 | FlyBaseID: | FBgn0036980 | Length: | 783 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002754.1 | Gene: | rac3a / 437027 | ZFINID: | ZDB-GENE-040718-256 | Length: | 192 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 80/206 - (38%) |
---|---|---|---|
Similarity: | 112/206 - (54%) | Gaps: | 36/206 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 ELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVN 76
Fly 77 VSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGC 139
Fly 140 KNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMP---DEARAVAKELG-VAYYETSVFTYFGVN 200
Fly 201 EVFENAIRSAL 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoBTB | NP_001262107.1 | RhoBTB | 12..210 | CDD:133275 | 79/203 (39%) |
RHO | 16..211 | CDD:197554 | 78/200 (39%) | ||
BTB | <392..446 | CDD:295341 | |||
BTB | 481..575 | CDD:279045 | |||
BTB | 485..582 | CDD:197585 | |||
rac3a | NP_001002754.1 | Rac1_like | 3..176 | CDD:206663 | 79/202 (39%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |