DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and RhoL

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster


Alignment Length:199 Identity:60/199 - (30%)
Similarity:89/199 - (44%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVS 78
            :|..:|||..||||.::.....|      :....::|||:......|          .||..:.:
  Fly    36 LKITIVGDGMVGKTCMLITYTRN------EFPEEYIPTVFDNHACNI----------AVDDRDYN 84

  Fly    79 LRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKN 141
            |.||||.|  |:::.|..:|..::..|||:||:|..|..|.|..|:||||.|...|||:|||.|.
  Fly    85 LTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKL 149

  Fly   142 DLRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKEL-GVAYYETSVFTYFGVNEVFEN 205
            |||....::                    .|...|.:.:.||: .....|.|......:.:|||.
  Fly   150 DLRIPNSEK--------------------FVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEE 194

  Fly   206 AIRS 209
            |:|:
  Fly   195 AVRA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 60/199 (30%)
RHO 16..211 CDD:197554 59/197 (30%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
RhoLNP_001247003.1 Rho 36..198 CDD:206641 59/197 (30%)
RHO 38..202 CDD:197554 59/197 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.