Sequence 1: | NP_001262107.1 | Gene: | RhoBTB / 40249 | FlyBaseID: | FBgn0036980 | Length: | 783 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998515.1 | Gene: | rhoac / 406659 | ZFINID: | ZDB-GENE-040426-2665 | Length: | 193 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 84/205 - (40%) |
---|---|---|---|
Similarity: | 108/205 - (52%) | Gaps: | 30/205 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 KCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVSL 79
Fly 80 RLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKND 142
Fly 143 LRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGV-AYYETSVFTYFGVNEVFENA 206
Fly 207 IRSALIARRQ 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoBTB | NP_001262107.1 | RhoBTB | 12..210 | CDD:133275 | 80/197 (41%) |
RHO | 16..211 | CDD:197554 | 79/197 (40%) | ||
BTB | <392..446 | CDD:295341 | |||
BTB | 481..575 | CDD:279045 | |||
BTB | 485..582 | CDD:197585 | |||
rhoac | NP_998515.1 | RhoA_like | 5..179 | CDD:206662 | 80/198 (40%) |
RHO | 8..181 | CDD:197554 | 81/199 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |