| Sequence 1: | NP_001262107.1 | Gene: | RhoBTB / 40249 | FlyBaseID: | FBgn0036980 | Length: | 783 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001300870.1 | Gene: | RHOA / 387 | HGNCID: | 667 | Length: | 193 | Species: | Homo sapiens |
| Alignment Length: | 207 | Identity: | 87/207 - (42%) |
|---|---|---|---|
| Similarity: | 111/207 - (53%) | Gaps: | 30/207 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 15 KCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVSL 79
Fly 80 RLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKND 142
Fly 143 LRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGV-AYYETSVFTYFGVNEVFENA 206
Fly 207 IRSALIARRQQR 218 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RhoBTB | NP_001262107.1 | RhoBTB | 12..210 | CDD:133275 | 82/197 (42%) |
| RHO | 16..211 | CDD:197554 | 81/197 (41%) | ||
| BTB | <392..446 | CDD:295341 | |||
| BTB | 481..575 | CDD:279045 | |||
| BTB | 485..582 | CDD:197585 | |||
| RHOA | NP_001300870.1 | RhoA_like | 5..179 | CDD:206662 | 82/198 (41%) |
| Effector region. /evidence=ECO:0000255 | 34..42 | 4/12 (33%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||