DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and Rac2

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001008385.1 Gene:Rac2 / 366957 RGDID:1307568 Length:192 Species:Rattus norvegicus


Alignment Length:215 Identity:80/215 - (37%)
Similarity:114/215 - (53%) Gaps:38/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVN 76
            :.:|||:|||.|||||.|:.:...|      .....::|||:  |.|.  .:|:      ||...
  Rat     2 QAIKCVVVGDGAVGKTCLLISYTTN------AFPGEYIPTVF--DNYS--ANVM------VDSKP 50

  Fly    77 VSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGC 139
            |:|.||||.|  |:|:.|..:|.::||.|:|||:.||.|..|.:..|:||:|..||..|:||||.
  Rat    51 VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGT 115

  Fly   140 KNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMP---DEARAVAKEL-GVAYYETSVFTYFGVN 200
            |.|||            .:|.|..:  ||...:.|   .:..|:||:: .|.|.|.|..|..|:.
  Rat   116 KLDLR------------DDKDTIEK--LKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLK 166

  Fly   201 EVFENAIRSALIAR--RQQR 218
            .||:.|||:.|..:  |||:
  Rat   167 TVFDEAIRAVLCPQPTRQQK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 76/203 (37%)
RHO 16..211 CDD:197554 75/200 (38%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
Rac2NP_001008385.1 Rac1_like 3..176 CDD:206663 76/202 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.