DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and rho4

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001018257.1 Gene:rho4 / 3361476 PomBaseID:SPAC16A10.04 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:70/201 - (34%)
Similarity:98/201 - (48%) Gaps:39/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVN--- 76
            |.|:|||...|||.|:..      .|.......:||||:  :.|         ..::..|.|   
pombe    16 KLVVVGDGGCGKTCLLIV------FSSGTFPERYVPTVF--ENY---------ITDITYGPNSKV 63

  Fly    77 VSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGC 139
            :.|.||||.|  ::|:.|..:|..|:|:||||||..|.||.|....||||::.|||..|::|||.
pombe    64 IELALWDTAGQEEYDRLRPLSYPNSNVILLCFSIDCPASLNNVTEKWYPEVQHFCPRTPIVLVGL 128

  Fly   140 KNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMP---DEARAVAKELGVAYYETSVFTYFGVNE 201
            |.|||   :|.|           ....|::..:.|   .:|::||..:...|.|.|.....||||
pombe   129 KADLR---KDRN-----------ATEVLRTQGLTPVTYQQAQSVALSMNAPYVECSAKENTGVNE 179

  Fly   202 VFENAI 207
            ||:.|:
pombe   180 VFQLAV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 70/201 (35%)
RHO 16..211 CDD:197554 69/200 (35%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
rho4NP_001018257.1 Rho4_like 12..189 CDD:206704 70/201 (35%)
RHO 17..185 CDD:197554 68/198 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.