DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and RhoU

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster


Alignment Length:207 Identity:72/207 - (34%)
Similarity:92/207 - (44%) Gaps:32/207 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QPHQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVV 72
            || |..:|||||||.|||||.||.:...|:      ....|:||  |.|.|....:|.|..    
  Fly   388 QP-QPSIKCVLVGDGAVGKTNLILSYLENR------FNPEHIPT--ASDIYNADVNVNESP---- 439

  Fly    73 DGVNVSLRLWDTFGDHDKD--RRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVI 135
                |.|.:.||.|....|  |...|..|||.|||||:..|.:.|..|..|.|:..:  ....:|
  Fly   440 ----VHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALI 498

  Fly   136 LVGCKNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGVAYYETSVFTYFGVN 200
            |||.:.|||......|.|...||           :.:...:|..:|..:|..|.|||..|...|.
  Fly   499 LVGTQADLRTSPNVLNKLQTNGE-----------EAISYADAWDLATTIGAKYIETSSATQDKVK 552

  Fly   201 EVFENAIRSALI 212
            :||:.||...|:
  Fly   553 DVFDTAIWEGLV 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 68/199 (34%)
RHO 16..211 CDD:197554 67/196 (34%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 68/197 (35%)
RHO 395..559 CDD:197554 65/192 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.